Clone Name | rbasd11b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PKP4_MOUSE (Q68FH0) Plakophilin-4 (Armadillo-related protein) | 30 | 5.2 | 2 | V2A_PSVJ (P28727) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (... | 30 | 6.8 |
---|
>PKP4_MOUSE (Q68FH0) Plakophilin-4 (Armadillo-related protein)| Length = 1190 Score = 30.4 bits (67), Expect = 5.2 Identities = 28/85 (32%), Positives = 34/85 (40%), Gaps = 17/85 (20%) Frame = +3 Query: 477 ETLQRPSTRGRALSR----------PSWIT-------RLVFRTCLFLHFGLARFTRSRSF 605 +TL +PS RA+ R PS++T R RT L FG T SR Sbjct: 196 QTLVQPSVANRAMRRVSSVPSRAQSPSYVTSTGVSPSRGSLRTSLGSGFGSPSVTDSRPL 255 Query: 606 *PLTLSSSCAPCIRWLGLCSDRPCT 680 P SSS P R S RP + Sbjct: 256 NPSAYSSSTLPAQRAASPYSQRPAS 280
>V2A_PSVJ (P28727) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 834 Score = 30.0 bits (66), Expect = 6.8 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 668 VRAKSKPTDARSTGTRKSQRSKASRTSESSQAKMQEEAGP 549 V A++ PT +KS+R +ASRTS S + GP Sbjct: 790 VSAQTSPTKQEGPWAQKSERVEASRTSRDSVSLFPASTGP 829 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,021,908 Number of Sequences: 219361 Number of extensions: 1859715 Number of successful extensions: 4749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4748 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)