Clone Name | rbasd11a18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MRP6_MOUSE (Q9R1S7) Multidrug resistance-associated protein 6 (A... | 31 | 3.8 | 2 | PTP1_CAEEL (P28191) Tyrosine-protein phosphatase 1 (EC 3.1.3.48)... | 31 | 3.8 |
---|
>MRP6_MOUSE (Q9R1S7) Multidrug resistance-associated protein 6 (ATP-binding| cassette sub-family C member 6) Length = 1498 Score = 30.8 bits (68), Expect = 3.8 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +2 Query: 359 LFNKWLTCCLYPQVNN-QPSSAGN 427 LF WL CC+ P +N Q +SAGN Sbjct: 142 LFGYWLLCCILPGINTVQQASAGN 165
>PTP1_CAEEL (P28191) Tyrosine-protein phosphatase 1 (EC 3.1.3.48)| (Protein-tyrosine phosphatase 1) Length = 1026 Score = 30.8 bits (68), Expect = 3.8 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +3 Query: 150 RPVKYLLANSIQERTSPSLVRPSRVLGSLPEG-MLSHAHRQLADFMKDGAIHVVDH 314 RP Y L + E S + P+RV S+P LS + + LAD + G VVDH Sbjct: 703 RPNVYRLGEEVDEPDSTMVPEPARVADSVPNSDKLSKSLQLLADSLNSG--KVVDH 756 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,893,834 Number of Sequences: 219361 Number of extensions: 2062513 Number of successful extensions: 5326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5326 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)