Clone Name | bags9p15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SC61A_YEAST (P32915) Protein transport protein SEC61 alpha subunit | 31 | 2.6 | 2 | PMT7_YEAST (Q06644) Dolichyl-phosphate-mannose--protein mannosyl... | 30 | 5.8 | 3 | MODU_DROME (P13469) DNA-binding protein modulo | 30 | 7.6 |
---|
>SC61A_YEAST (P32915) Protein transport protein SEC61 alpha subunit| Length = 480 Score = 31.2 bits (69), Expect = 2.6 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 136 LPSNSYLDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLL 258 + SN LDL P+ F+P +IA E +++L WT + LL Sbjct: 1 MSSNRVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLL 41
>PMT7_YEAST (Q06644) Dolichyl-phosphate-mannose--protein mannosyltransferase 7| (EC 2.4.1.109) Length = 662 Score = 30.0 bits (66), Expect = 5.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 154 LDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLL 258 L L GPY K++P+ I + G G K L++ FL+ Sbjct: 4 LRLQGPYRKYIPYNIFQQCGIGHLKTLDYIFAFLI 38
>MODU_DROME (P13469) DNA-binding protein modulo| Length = 542 Score = 29.6 bits (65), Expect = 7.6 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = -1 Query: 564 QGFWRSILANASRISLIPCIASPRSLLRRRDLCAEIGHPLIHVPTQICQDCNLFMGLMAF 385 +GF +S LAN S ++ P P SLL+ R L + P + +D G F Sbjct: 464 EGFCKSFLANESIVNNAPIFIEPNSLLKHRLLKKRLAIGQTRAPRKFQKDTKPNFGKKPF 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,190,129 Number of Sequences: 219361 Number of extensions: 1677968 Number of successful extensions: 3976 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3975 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)