| Clone Name | bags9o01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCAP_HUMAN (Q12770) Sterol regulatory element-binding protein cl... | 35 | 0.22 | 2 | STTP1_RAT (Q496Z0) Stat3-interacting protein (StIP1) | 33 | 0.83 | 3 | SCAP_CRIGR (P97260) Sterol regulatory element-binding protein cl... | 32 | 1.1 | 4 | RNT2_MOUSE (Q9CQ01) Ribonuclease T2 precursor (EC 3.1.27.-) (Rib... | 30 | 5.4 | 5 | WDR46_HUMAN (O15213) WD-repeat protein 46 (WD-repeat protein BING4) | 30 | 7.0 |
|---|
>SCAP_HUMAN (Q12770) Sterol regulatory element-binding protein| cleavage-activating protein (SREBP cleavage-activating protein) (SCAP) Length = 1278 Score = 34.7 bits (78), Expect = 0.22 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 171 DPLLCHVSTVHRLRWQKPDSAVEKAAVELASCGADHCVRVFAVRDS 308 D + CH++ QKP +A++ AA L + DH +RVF + DS Sbjct: 1063 DTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDS 1108
>STTP1_RAT (Q496Z0) Stat3-interacting protein (StIP1)| Length = 821 Score = 32.7 bits (73), Expect = 0.83 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Frame = +3 Query: 51 IIAVGMDNGLIELWSVXXXXXXXXXXXXXXPLNVACMLRFDPLLCHVSTVHRLRWQKPDS 230 I+AVG+++G I ++S + P H + RL W+ Sbjct: 737 IVAVGLESGKICIYSWSKTNQETKDWTS--------CVETTPSQSHTLGIRRLCWKSCSG 788 Query: 231 AVEKAA-----VELASCGADHCVRVFAV 299 + E++ ++ ASCG DH V+++ V Sbjct: 789 STEQSEEGTEWLDFASCGEDHTVKIYRV 816
>SCAP_CRIGR (P97260) Sterol regulatory element-binding protein| cleavage-activating protein (SREBP cleavage-activating protein) (SCAP) Length = 1276 Score = 32.3 bits (72), Expect = 1.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 183 CHVSTVHRLRWQKPDSAVEKAAVELASCGADHCVRVFAVRDS 308 CH++ QKP +A+ AA L + DH +RVF + DS Sbjct: 1065 CHLTHTVPCAHQKPITALRAAAGRLVTGSQDHTLRVFRLEDS 1106
>RNT2_MOUSE (Q9CQ01) Ribonuclease T2 precursor (EC 3.1.27.-) (Ribonuclease 6)| Length = 259 Score = 30.0 bits (66), Expect = 5.4 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +2 Query: 2 SQHWPGTGRXXXXXCRH---YCRWHGQWTDRALEC 97 +QHWP T C+ Y HG W DRA +C Sbjct: 45 TQHWPPTVCKEVNSCQDSLDYWTIHGLWPDRAEDC 79
>WDR46_HUMAN (O15213) WD-repeat protein 46 (WD-repeat protein BING4)| Length = 610 Score = 29.6 bits (65), Expect = 7.0 Identities = 30/112 (26%), Positives = 44/112 (39%), Gaps = 3/112 (2%) Frame = +3 Query: 51 IIAVGMDNGLIELWSVXXXXXXXXXXXXXXPLNVACMLRFDPLLCHVSTVHRLRWQKPDS 230 +I +G NG + LWS A +LCH V + Sbjct: 331 VIHLGHSNGTVSLWS------------------PAMKEPLAKILCHRGGVRAV------- 365 Query: 231 AVEKAAVELASCGADHCVRVFAVRDS*GIYATL*LRNFEH--PHL-FSQQDI 377 AV+ +A+ G DH +++F +R G Y L R H HL FSQ+ + Sbjct: 366 AVDSTGTYMATSGLDHQLKIFDLR---GTYQPLSTRTLPHGAGHLAFSQRGL 414 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,541,664 Number of Sequences: 219361 Number of extensions: 1453972 Number of successful extensions: 3465 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3460 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)