| Clone Name | bags9n04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HUTU_BACAN (Q81Y46) Urocanate hydratase (EC 4.2.1.49) (Urocanase... | 32 | 1.7 | 2 | XDH_HUMAN (P47989) Xanthine dehydrogenase/oxidase [Includes: Xan... | 29 | 8.2 | 3 | ANR12_HUMAN (Q6UB98) Ankyrin repeat domain-containing protein 12... | 29 | 8.2 |
|---|
>HUTU_BACAN (Q81Y46) Urocanate hydratase (EC 4.2.1.49) (Urocanase)| (Imidazolonepropionate hydrolase) Length = 552 Score = 31.6 bits (70), Expect = 1.7 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Frame = -1 Query: 497 RVCILITVNLDQSLATQGR*WDQKKEKKKTELLGDSCQLMVKDVSPTMTPHLFPPQNCT- 321 R C + T +L+++LA + +KKE LLG++ +++ + V +TP L Q Sbjct: 206 RYCDMYTESLEEALAVANE-YKEKKEPISIGLLGNAAEILPELVKRNITPDLVTDQTSAH 264 Query: 320 -PLDVHASLSY 291 PL+ + + Y Sbjct: 265 DPLNGYIPVGY 275
>XDH_HUMAN (P47989) Xanthine dehydrogenase/oxidase [Includes: Xanthine| dehydrogenase (EC 1.17.1.4) (XD); Xanthine oxidase (EC 1.17.3.2) (XO) (Xanthine oxidoreductase)] Length = 1332 Score = 29.3 bits (64), Expect = 8.2 Identities = 22/63 (34%), Positives = 28/63 (44%) Frame = -1 Query: 389 CQLMVKDVSPTMTPHLFPPQNCTPLDVHASLSYVQDPHHPSAL*TVLVTSNKTNLGINRQ 210 C KD S +++P LF P+ TPLD Q+P P L + T K Q Sbjct: 179 CMNQKKDHSVSLSPSLFKPEEFTPLDP------TQEPIFPPELLRLKDTPRK-------Q 225 Query: 209 LRF 201 LRF Sbjct: 226 LRF 228
>ANR12_HUMAN (Q6UB98) Ankyrin repeat domain-containing protein 12 (Ankyrin| repeat-containing cofactor 2) (GAC-1 protein) Length = 2062 Score = 29.3 bits (64), Expect = 8.2 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -1 Query: 416 KKTELLGDSCQLMVKDVSPTMTPHLFPPQNCT---PLDVHASLSYV--QDP 279 ++TEL G+SC P P FP Q+ + + H SLSYV Q+P Sbjct: 1469 RQTELPGNSCAQDPASFMPPQQPCSFPSQSLSDAESISKHMSLSYVANQEP 1519 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,341,835 Number of Sequences: 219361 Number of extensions: 1613485 Number of successful extensions: 3419 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3419 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)