| Clone Name | bags9i07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1773_SYNY3 (P73623) Hypothetical protein sll1773 | 32 | 1.6 | 2 | VGLM_NYV (Q83887) Envelope polyprotein precursor [Contains: Glyc... | 31 | 2.1 | 3 | RNR_CHLMU (Q9PK00) Ribonuclease R (EC 3.1.-.-) (RNase R) (VacB p... | 31 | 2.1 | 4 | Y114_MYCPN (P75448) Putative acetyltransferase MPN114 (EC 2.3.1.... | 31 | 2.8 |
|---|
>Y1773_SYNY3 (P73623) Hypothetical protein sll1773| Length = 232 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 188 SFSFFSYYAPCHQNHLCANITNDDHTTIGDALTARARAGLAIIS 57 SFSF YY P H N + N+D+ G + I++ Sbjct: 23 SFSFSHYYDPAHMNFSNLRVINEDYIAPGQGFATHGHKDMEIVT 66
>VGLM_NYV (Q83887) Envelope polyprotein precursor [Contains: Glycoprotein 1| (G1); Glycoprotein 2 (G2)] Length = 1140 Score = 31.2 bits (69), Expect = 2.1 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 5/123 (4%) Frame = -3 Query: 457 DTSSKILCVKITNNY-LTTIEDALRASSTVRMFNRWYKCPHQQPTTHHTSSSMECMLI-- 287 + +K + +K T N +TT E A ++ TV ++ H PT H + CM + Sbjct: 101 EAKTKEVSLKGTCNIPVTTFEAAYKSRKTVICYDLACNQTHCLPTVHLIAPVQTCMSVRS 160 Query: 286 --VCKITKRVH*TWKK*SCLPRSLCVNRCFKFIRFHSLSSLIMRHVIKIIYVPILPTMII 113 + ++ R+ ++K C+ L C FI H+++ H + +PI ++ Sbjct: 161 CMIGLLSSRIQVIYEKTYCVTGQLVEGLC--FIPTHTIALTQPGHTYDTMTLPITCFLVA 218 Query: 112 QPL 104 + L Sbjct: 219 KKL 221
>RNR_CHLMU (Q9PK00) Ribonuclease R (EC 3.1.-.-) (RNase R) (VacB protein| homolog) Length = 692 Score = 31.2 bits (69), Expect = 2.1 Identities = 18/62 (29%), Positives = 33/62 (53%) Frame = -1 Query: 480 LSFLIYCLTHHQKSYVSKLPTTILQPLKMPLEHLQQSVCSIVGISVHINNQQHIIQALQW 301 LSF++ L H +KLP + K+ LE L + + + ISV + + + QA++W Sbjct: 586 LSFVLPELCHEGFIPAAKLPKKYVIKTKLGLEELPEHLLPGIPISVQLASVTLLTQAIEW 645 Query: 300 SV 295 ++ Sbjct: 646 TL 647
>Y114_MYCPN (P75448) Putative acetyltransferase MPN114 (EC 2.3.1.-)| (C09_orf600) Length = 600 Score = 30.8 bits (68), Expect = 2.8 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 472 PHLLLDTSSKILCVKITNNYLTTIEDALRASSTVRMFNRWY 350 P +LLD + V + N LTT LR S+ FNRW+ Sbjct: 263 PEMLLDIYNSAFIVNLDNVELTTPLQLLRNSTWTPNFNRWH 303 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,208,968 Number of Sequences: 219361 Number of extensions: 1531313 Number of successful extensions: 3453 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3453 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)