Clone Name | bags9i05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | O52E6_HUMAN (Q96RD3) Olfactory receptor 52E6 | 30 | 6.1 | 2 | O52E2_HUMAN (Q8NGJ4) Olfactory receptor 52E2 | 30 | 6.1 | 3 | STAB1_HUMAN (Q9NY15) Stabilin-1 precursor (FEEL-1 protein) (MS-1... | 30 | 8.0 |
---|
>O52E6_HUMAN (Q96RD3) Olfactory receptor 52E6| Length = 313 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +1 Query: 217 CGSHLSIRACVPSATIAIDIFALHCNFVNLPQHFNILINNCLNFVPLVLTEQLNKLYFVG 396 CGSH+ + + +T A F HC ++PQ+ +I + N VP LN + + Sbjct: 242 CGSHIGV--ILAFSTPAFFSFFTHCFGHDIPQYIHIFLANLYVVVP----PTLNPVIYGV 295 Query: 397 VSEHVR 414 ++H+R Sbjct: 296 RTKHIR 301
>O52E2_HUMAN (Q8NGJ4) Olfactory receptor 52E2| Length = 325 Score = 30.0 bits (66), Expect = 6.1 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 217 CGSHLSIRACVPSATIAIDIFALHCNFVNLPQHFNILINNCLNFVPLVL 363 CGSH+ + + T A+ F HC N+P++ +IL+ N VP +L Sbjct: 242 CGSHVCV--ILAFYTPALFSFMTHCFGRNVPRYIHILLANLYVVVPPML 288
>STAB1_HUMAN (Q9NY15) Stabilin-1 precursor (FEEL-1 protein) (MS-1 antigen)| Length = 2570 Score = 29.6 bits (65), Expect = 8.0 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 229 LSIRACVPSATIAIDIFALHCNFVNLPQHFNILINNCLNFVPLVLTEQ 372 L+ C P++ + +DIF C +++ P N+L C ++ + EQ Sbjct: 672 LNTSTCPPNS-VKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQ 718 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,467,410 Number of Sequences: 219361 Number of extensions: 1585114 Number of successful extensions: 3044 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3044 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)