Clone Name | bags9c18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precurs... | 30 | 3.9 |
---|
>SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precursor (Acetyl LDL| receptor) (Scavenger receptor class F member 1) Length = 830 Score = 30.0 bits (66), Expect = 3.9 Identities = 19/65 (29%), Positives = 26/65 (40%) Frame = +2 Query: 20 PGXGSC*YKPNWTKLTCRQPIELACHSKISSVEFILYLA*AKCFWLKHEAFSRC*YSIHG 199 P G C +P W TCR+P + C++ + E K W RC + HG Sbjct: 143 PATGVCHCEPGWWSSTCRRPCQ--CNTAAARCEQATGACVCKPGWWGRRCSFRC--NCHG 198 Query: 200 CYLEQ 214 EQ Sbjct: 199 SPCEQ 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,949,557 Number of Sequences: 219361 Number of extensions: 1087729 Number of successful extensions: 1981 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1979 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)