| Clone Name | bags9b02 |
|---|---|
| Clone Library Name | barley_pub |
>ADAM8_MOUSE (Q05910) ADAM 8 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 8) (Cell surface antigen MS2) (Macrophage cysteine-rich glycoprotein) (CD156 antigen) Length = 826 Score = 35.4 bits (80), Expect = 0.095 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 18/105 (17%) Frame = -2 Query: 510 QDHSKLGS----------MVNTEIPYIKQQSYTMLYV*LITWHLDRAY--------KHNF 385 Q+ KLGS +VN ++ S+ ++ V L W+ D+ Y NF Sbjct: 207 QEFQKLGSREAVRQRVLEVVNHVDKLYQELSFRVVLVGLEIWNKDKFYISRYANVTLENF 266 Query: 384 LVWQRKHPSRSNMERRHPHTNSQLRRHLVIILASELSITKIIGLC 250 L W+ + N++ +HPH N QL V + S + + K+ LC Sbjct: 267 LSWREQ-----NLQGQHPHDNVQLITG-VDFIGSTVGLAKVSALC 305
>LRP1B_HUMAN (Q9NZR2) Low-density lipoprotein receptor-related protein 1B| precursor (Low-density lipoprotein receptor-related protein-deleted in tumor) (LRP-DIT) Length = 4599 Score = 30.4 bits (67), Expect = 3.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 321 CSCGDGASPCSSVMDVSAAKQGSCACRH 404 C+ DG PCS + ++ + +CAC H Sbjct: 1531 CAANDGKGPCSHMCLINHNRSAACACPH 1558
>JHD3A_MOUSE (Q8BW72) JmjC domain-containing histone demethylation protein 3A| (EC 1.14.11.-) (Jumonji domain-containing protein 2A) Length = 1064 Score = 30.4 bits (67), Expect = 3.0 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 415 APRSCLQAQLPCLAAETSITLEHGEAPSPHEQPIETTPSHH 293 APRS + +L +A E ++LE + QP+ P HH Sbjct: 567 APRSISEQELAEVADEYMLSLEENKKTKGRRQPLSKLPRHH 607
>BRN3_CHICK (Q91998) Brain-specific homeobox/POU domain protein 3 (Brn-3)| Length = 341 Score = 29.6 bits (65), Expect = 5.2 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +1 Query: 37 LQKHLPVSGPE---GPNELEKIAVRFEEKIYNAATSQSD 144 L H +SGPE P ELE A RF+++ +Q+D Sbjct: 172 LASHAVISGPETETDPRELESFAERFKQRRIKLGVTQAD 210
>LRP1B_MOUSE (Q9JI18) Low-density lipoprotein receptor-related protein 1B| precursor (Low-density lipoprotein receptor-related protein-deleted in tumor) (LRP-DIT) Length = 4599 Score = 28.9 bits (63), Expect = 8.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 321 CSCGDGASPCSSVMDVSAAKQGSCACRH 404 C+ +G PCS + ++ + +CAC H Sbjct: 1531 CAANEGRGPCSHLCLINHNRSAACACPH 1558 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,514,782 Number of Sequences: 219361 Number of extensions: 1516760 Number of successful extensions: 4441 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4440 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)