| Clone Name | bags9a23 |
|---|---|
| Clone Library Name | barley_pub |
>TNIK_HUMAN (Q9UKE5) TRAF2 and NCK-interacting kinase (EC 2.7.11.1)| Length = 1360 Score = 32.3 bits (72), Expect = 1.0 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +1 Query: 313 EGSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERETAQA 444 E E+RR EQ RE++ +Q E+RR EQ RE E +A Sbjct: 397 EQKEQRRRLEEQQRREKELRKQQEREQRRHYEEQMRREEERRRA 440
>LMO7_HUMAN (Q8WWI1) LIM domain only protein 7 (LOMP) (F-box only protein 20)| Length = 1683 Score = 30.0 bits (66), Expect = 5.0 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 322 EERRAKIEQWNRERDAPARQGSEERRAKI-EQWNRERETAQ 441 EE R + E+W +E+D ++ + + K+ E+W R ++ A+ Sbjct: 1228 EEERKRQERWQKEQDRLLQEKYQREQEKLREEWQRAKQEAE 1268
>CPLX1_HUMAN (O14810) Complexin-1 (Synaphin-2)| Length = 134 Score = 30.0 bits (66), Expect = 5.0 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERETAQ 441 G EE+ + ER RQ EER+AK + ERE + Sbjct: 22 GDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVR 63
>M4K4_HUMAN (O95819) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1239 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 322 EERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 E+RR EQ RER+A +Q E+RR + E+ R E Sbjct: 404 EQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEE 440
>M4K4_MOUSE (P97820) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1233 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 322 EERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 E+RR EQ RER+A +Q E+RR + E+ R E Sbjct: 403 EQRRRLEEQQRREREARRQQEREQRRREQEEKRRLEE 439
>CPLX1_RAT (P63041) Complexin-1 (Synaphin-2)| Length = 134 Score = 29.6 bits (65), Expect = 6.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ + ER RQ EER+AK + ERE Sbjct: 22 GDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE 60
>CPLX1_MOUSE (P63040) Complexin-1 (Synaphin-2) (921-S)| Length = 134 Score = 29.6 bits (65), Expect = 6.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ + ER RQ EER+AK + ERE Sbjct: 22 GDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE 60
>XE7_HUMAN (Q02040) B-lymphocyte antigen precursor (B-lymphocyte surface| antigen) (721P) (Protein XE7) Length = 695 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 322 EERRAKIEQWNRERDAPARQGSEERRAK-IEQWNRERE 432 E + + EQ RE++A RQ +EER+ K +E+ RER+ Sbjct: 280 ELEQQREEQKRREKEAEERQRAEERKQKELEELERERK 317
>CPLX2_RAT (P84087) Complexin-2 (Synaphin-1)| Length = 134 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ ++ ER RQ EER+AK + ERE Sbjct: 22 GEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE 60
>CPLX2_MOUSE (P84086) Complexin-2 (Synaphin-1) (921-L)| Length = 134 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ ++ ER RQ EER+AK + ERE Sbjct: 22 GEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE 60
>CPLX2_HUMAN (Q6PUV4) Complexin-2 (Synaphin-1)| Length = 134 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ ++ ER RQ EER+AK + ERE Sbjct: 22 GEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE 60
>CPLX2_BOVIN (P84088) Complexin-2 (Synaphin-1)| Length = 134 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 316 GSEERRAKIEQWNRERDAPARQGSEERRAKIEQWNRERE 432 G EE+ ++ ER RQ EER+AK + ERE Sbjct: 22 GEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,158,595 Number of Sequences: 219361 Number of extensions: 558089 Number of successful extensions: 1802 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1782 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)