| Clone Name | bags9a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocy... | 83 | 5e-18 | 2 | Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA int... | 33 | 0.42 | 3 | ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit... | 30 | 3.6 |
|---|
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 83.2 bits (204), Expect(2) = 5e-18 Identities = 37/61 (60%), Positives = 49/61 (80%) Frame = +2 Query: 56 LDRVRTFYELLNLPFETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPMDAERRISQILG 235 LDRVRT++ELLN+PFE LL FIAE + +F+ EY ++LKVNVPGR+ P DA+ R+ +IL Sbjct: 993 LDRVRTYFELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRDTPSDAQSRLLEILS 1052 Query: 236 H 238 H Sbjct: 1053 H 1053 Score = 26.6 bits (57), Expect(2) = 5e-18 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 3 QALAAIPSIDSEAVQQ 50 QA+AAIP ID E VQQ Sbjct: 976 QAMAAIPYIDGETVQQ 991
>Y13L_BPT4 (P39505) Hypothetical 9.4 kDa protein in nrdB-nrdA intergenic| region Length = 83 Score = 33.1 bits (74), Expect = 0.42 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = -3 Query: 475 LHPKYHTFTRIKNKRSIQNTTNLLSMRQQIVHYLPICRHQKKKPNRNNKINYSYKESR 302 L+P Y T + ++ + T +L+S+R + P C H KK N+ N + + Y + + Sbjct: 21 LNPMYGTISPTRDVPHTKETRDLISLRTKQGAEYPPCPHCGKKVNKGNALRWHYDKCK 78
>ALG14_DEBHA (Q6BMD0) UDP-N-acetylglucosamine transferase subunit ALG14 (EC| 2.4.1.-) (Asparagine linked glycosylation protein 14) Length = 232 Score = 30.0 bits (66), Expect = 3.6 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 56 LDRVRTFYELLNLP-FETLLGFIAEQEYLFSAKEYLSILKVNVPGREIPM 202 L R RT E + L F T+ I+ ++L+ ++ SIL +N PG +P+ Sbjct: 119 LHRARTVGESIILSVFSTVRSLISTIKHLYELPQFPSILLLNGPGTSVPL 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,962,758 Number of Sequences: 219361 Number of extensions: 977033 Number of successful extensions: 2236 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2234 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)