Clone Name | basdp18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AAPQ_RHILV (Q52813) General L-amino acid transport system permea... | 29 | 6.9 |
---|
>AAPQ_RHILV (Q52813) General L-amino acid transport system permease protein| aapQ Length = 400 Score = 28.9 bits (63), Expect = 6.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -2 Query: 356 IYXXXXSTIFY*ILTDTVIIGTIWDFRH----AIQRTTTASG 243 +Y +IFY ILT +++G +W H + R+ TASG Sbjct: 22 MYDPKYRSIFYQILTIVILVGFVWWVAHNTAVNLARSNTASG 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,615,944 Number of Sequences: 219361 Number of extensions: 1005684 Number of successful extensions: 2352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2351 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)