| Clone Name | basdp14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NTHL1_HUMAN (P78549) Endonuclease III-like protein 1 (EC 4.2.99.18) | 29 | 4.1 | 2 | BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231) | 28 | 7.0 | 3 | HEM1_CHLVI (P28462) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR) | 28 | 9.1 |
|---|
>NTHL1_HUMAN (P78549) Endonuclease III-like protein 1 (EC 4.2.99.18)| Length = 312 Score = 28.9 bits (63), Expect = 4.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 105 WHDLGGLVLHVGSEXVLGVAPALLMVLKHSCCP 7 WH++ GL++ G + L V P L + CP Sbjct: 275 WHEINGLLVGFGQQTCLPVHPRCHACLNQALCP 307
>BSN_HUMAN (Q9UPA5) Bassoon protein (Zinc-finger protein 231)| Length = 3925 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 11 QQECLRTMRRAGATPSTXSEPTCRTRPPRSCQEXTSSXP 127 ++E + +++AG PS+ S R RPP Q P Sbjct: 3468 EREAVERLQKAGPKPSSLSMAHSRVRPPMRSQASEEESP 3506
>HEM1_CHLVI (P28462) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR)| Length = 424 Score = 27.7 bits (60), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 50 TPSTXSEPTCRTRPPRSCQE 109 TP T S PT R PR+C+E Sbjct: 204 TPGTSSSPTGRNPRPRACEE 223 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,318,257 Number of Sequences: 219361 Number of extensions: 251281 Number of successful extensions: 785 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)