Clone Name | basdp13 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AKR1_CANAL (Q5AL27) Palmitoyltransferase AKR1 (EC 2.3.1.-) (Anky... | 28 | 5.2 |
---|
>AKR1_CANAL (Q5AL27) Palmitoyltransferase AKR1 (EC 2.3.1.-) (Ankyrin| repeat-containing protein AKR1) Length = 813 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 14 YSLRSCHFHLKVDRWPLFQSFVLWCKCSVNTSCPW*ETKGLFSW 145 Y ++ HFH V W LFQ + C V T + KGL +W Sbjct: 632 YGYKNHHFHFNVFMWDLFQCVWVSFLCIVQT---FQILKGLTTW 672 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,551,750 Number of Sequences: 219361 Number of extensions: 286126 Number of successful extensions: 668 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)