| Clone Name | basdp06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CXA7_CANFA (P28228) Gap junction alpha-7 protein (Connexin-45) (... | 31 | 0.98 | 2 | JPH3_MOUSE (Q9ET77) Junctophilin-3 (Junctophilin type 3) (JP-3) | 29 | 2.9 | 3 | JPH3_HUMAN (Q8WXH2) Junctophilin-3 (Junctophilin type 3) (JP-3) | 29 | 3.7 | 4 | ZBED1_HUMAN (O96006) Zinc finger BED domain-containing protein 1... | 28 | 8.3 |
|---|
>CXA7_CANFA (P28228) Gap junction alpha-7 protein (Connexin-45) (Cx45)| Length = 396 Score = 30.8 bits (68), Expect = 0.98 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = -3 Query: 209 QQLGDMLHLCPADQETWQ*LLKMVREKKLRELRIYCHQ-----PRYRFAKI 72 QQ G PAD ET Q +KMV+E+ ++ Y HQ PR + AK+ Sbjct: 322 QQYGSHEENLPADLETLQREIKMVQERLDLAIQAYSHQNNPHGPREKKAKV 372
>JPH3_MOUSE (Q9ET77) Junctophilin-3 (Junctophilin type 3) (JP-3)| Length = 744 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 180 SRRPGNMAMTFEDGEREETKRAKNILSS 97 +RR G MTF DG +EE K +N+L S Sbjct: 318 NRRHGYGCMTFPDGTKEEGKYKQNVLVS 345
>JPH3_HUMAN (Q8WXH2) Junctophilin-3 (Junctophilin type 3) (JP-3)| Length = 748 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 180 SRRPGNMAMTFEDGEREETKRAKNIL 103 +RR G MTF DG +EE K +NIL Sbjct: 318 NRRHGYGCMTFPDGTKEEGKYKQNIL 343
>ZBED1_HUMAN (O96006) Zinc finger BED domain-containing protein 1 (dREF homolog)| (Putative Ac-like transposable element) Length = 694 Score = 27.7 bits (60), Expect = 8.3 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = -2 Query: 216 ALATAWRYVAPVS-RRPGNMAMTFEDGEREETKRAKNILSSAXIQVCKDLSPRA------ 58 A ATA+ + P S ++PG A+ + G ++K+ + + ++ +C+ L P + Sbjct: 89 AFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPT 148 Query: 57 FLIAVIKADLQYLSP 13 F + + AD +Y P Sbjct: 149 FKVLLKTADPRYELP 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,471,975 Number of Sequences: 219361 Number of extensions: 408874 Number of successful extensions: 1191 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)