Clone Name | basdo04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to riboso... | 41 | 0.002 | 2 | TAR1_KLULA (Q6CQE5) Protein TAR1 | 41 | 0.002 | 3 | RBPSL_HUMAN (Q9UBG7) Recombining binding protein suppressor of h... | 30 | 4.3 |
---|
>TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to ribosomal RNA| protein 1) Length = 124 Score = 41.2 bits (95), Expect = 0.002 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -1 Query: 481 HGFTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 377 + FT++FT FFS F H T SLSV+++YLAL G Sbjct: 25 NNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 59
>TAR1_KLULA (Q6CQE5) Protein TAR1| Length = 109 Score = 41.2 bits (95), Expect = 0.002 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -1 Query: 481 HGFTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 377 + FT++FT FFS F H T SLSV+++YLAL G Sbjct: 10 NNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 44
>RBPSL_HUMAN (Q9UBG7) Recombining binding protein suppressor of hairless-like| protein (Transcription factor RBP-L) Length = 516 Score = 30.0 bits (66), Expect = 4.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 524 RSEITFPLPLLGSSARFHVLFHYPLGVLFTFPSRYYFAIGHPGV 393 R+ IT P+ L+ + F YP FT+ Y GHPGV Sbjct: 449 RAPITIPMSLVRADGLF-----YPSAFSFTYTPEYSVRPGHPGV 487 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,135,251 Number of Sequences: 219361 Number of extensions: 1547358 Number of successful extensions: 3217 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3217 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)