Clone Name | basdm20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POF13_SCHPO (O94334) F-box protein pof13 | 32 | 1.2 | 2 | E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein) | 31 | 2.1 | 3 | YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region | 31 | 2.7 | 4 | TILS_RHIME (Q92JY3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 29 | 7.9 | 5 | TIM44_YEAST (Q01852) Import inner membrane translocase subunit T... | 29 | 7.9 | 6 | CN12L_DROME (Q9VTL1) CSN12-like protein | 29 | 7.9 |
---|
>POF13_SCHPO (O94334) F-box protein pof13| Length = 396 Score = 32.0 bits (71), Expect = 1.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 437 TLTPVIFGSYLVFRVCLDLVPLAQPAPKQCFTPRCPVNCC 318 TLT ++F+ LD +P P +C RCP+N C Sbjct: 223 TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNAC 262
>E41LA_HUMAN (Q9HCS5) Band 4.1-like protein 4A (NBL4 protein)| Length = 598 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -1 Query: 197 PSFILVMDRSPRFGSISSDNRPIKTRFRYGSGGFRSLNQATAYESPAHSSTGTRSE 30 P F R+P GS + +P++ R + SG L Q S ++S+G+ SE Sbjct: 435 PKFPYTRRRNPSCGSDNDSVQPVRRRKAHNSGEDSDLKQRRRSRSRCNTSSGSESE 490
>YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region| Length = 154 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 250 VVVRGEMPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGCASG 378 V+ +G +PL PR W++ + AQQLT ++ G+G +G Sbjct: 82 VLEKGGLPLNPRGEWYTKDTI-AQQLTMRAFMEELRGSGVDTG 123
>TILS_RHIME (Q92JY3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 453 Score = 29.3 bits (64), Expect = 7.9 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = -2 Query: 250 LIR*FFNISRFGPLLSFIQASSWSWIDHPGSGP*AVTIALLRLAFATAPVGSVPLTKPLP 71 ++R F ++R + SF+QA SWID P + A +R AT+ G +P PL Sbjct: 172 VLRPFLGLAR-AEIRSFLQARGVSWIDDPSNANPAFERVRVRARIATS--GGMP--TPLG 226 Query: 70 MSRRLILQQAR 38 R+ AR Sbjct: 227 NGRQRAASSAR 237
>TIM44_YEAST (Q01852) Import inner membrane translocase subunit TIM44,| mitochondrial precursor (Mitochondrial protein import protein 1) (Inner membrane import site protein 45) (ISP45) (Membrane import machinery protein MIM44) Length = 431 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 373 SGTKSRQTLNTRYDPKITGVKVGQXXXXXXASSSRGKQPGSP 498 SGT SR TL RY + TG+ V + + ++G P SP Sbjct: 10 SGTSSR-TLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSP 50
>CN12L_DROME (Q9VTL1) CSN12-like protein| Length = 395 Score = 29.3 bits (64), Expect = 7.9 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 407 LVFRVCLDLVPLAQPAPKQC--FTP 339 L++RVCLDL LAQ K C FTP Sbjct: 108 LMYRVCLDLRYLAQACEKHCQGFTP 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,827,662 Number of Sequences: 219361 Number of extensions: 1727890 Number of successful extensions: 4084 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4082 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)