ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basdk13 |
|---|---|
| Clone Library Name | barley_pub |
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGAK 163 ISCGQVSSALSPCISYARGNGAK Sbjct: 27 ISCGQVSSALSPCISYARGNGAK 49
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGAK 163 ISCGQVSSALSPCISYARGNGAK Sbjct: 27 ISCGQVSSALSPCISYARGNGAK 49
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGAK 163 ISCGQVSSALSPCISYARGNGAK Sbjct: 27 ISCGQVSSALSPCISYARGNGAK 49
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGAK 163 ISCGQVSSALSPCISYARGNGAK Sbjct: 27 ISCGQVSSALSPCISYARGNGAK 49
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 42.0 bits (97), Expect = 5e-04 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ISCGQV+SA++PCISYARG G+ Sbjct: 29 ISCGQVASAIAPCISYARGQGS 50
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 41.2 bits (95), Expect = 8e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ISCGQVSSA+ PC++YARG GA Sbjct: 2 ISCGQVSSAIGPCLAYARGAGA 23
>NLTP2_SORBI (Q43194) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 122 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++CGQVSSA+ PC+SYARG G+ Sbjct: 31 VTCGQVSSAIGPCLSYARGQGS 52
>NLTP1_PRUPE (P81402) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru p 3) (Pru p 1) Length = 91 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSSAL+PCI Y RG GA Sbjct: 1 ITCGQVSSALAPCIPYVRGGGA 22
>NLTP1_PRUAR (P81651) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru ar 3) Length = 91 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSS+L+PCI Y RG GA Sbjct: 1 ITCGQVSSSLAPCIGYVRGGGA 22
>NLTP3_ORYSA (Q42999) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 ISCGQV+SA+SPC+SYARG Sbjct: 28 ISCGQVNSAVSPCLSYARG 46
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 ISCGQV+SA+SPC+SYARG Sbjct: 28 ISCGQVNSAVSPCLSYARG 46
>NLTP_PRUAV (Q9M5X8) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pru av 3) Length = 117 Score = 38.1 bits (87), Expect = 0.007 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++CGQVSS L+PCI+Y RG GA Sbjct: 27 LTCGQVSSNLAPCIAYVRGGGA 48
>NLTP1_PRUDU (Q43017) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 38.1 bits (87), Expect = 0.007 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSS L+PCI Y RG GA Sbjct: 27 ITCGQVSSNLAPCIPYVRGGGA 48
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 38.1 bits (87), Expect = 0.007 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 I+CGQVSSAL PC +YA+G+G Sbjct: 27 ITCGQVSSALGPCAAYAKGSG 47
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 38.1 bits (87), Expect = 0.007 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 ISCGQVSSA++ C+SYARG G Sbjct: 27 ISCGQVSSAIALCLSYARGQG 47
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 37.7 bits (86), Expect = 0.009 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSS L+PCI+Y +G GA Sbjct: 1 ITCGQVSSNLAPCINYVKGGGA 22
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 36.2 bits (82), Expect = 0.025 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQV+S+L+PCI Y R GA Sbjct: 25 ITCGQVTSSLAPCIGYVRSGGA 46
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 35.8 bits (81), Expect = 0.033 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 +SCGQVSS+L+PCISY GA Sbjct: 26 LSCGQVSSSLAPCISYLTKGGA 47
>NLTP4_VITSX (P80274) Nonspecific lipid-transfer protein P4 (LTP P4) (Fragment)| Length = 37 Score = 35.8 bits (81), Expect = 0.033 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++CGQV+SALSPCI Y + +GA Sbjct: 2 VTCGQVASALSPCIDYLQKDGA 23
>NLTP1_ORYSA (P23096) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (PAPI) Length = 116 Score = 35.4 bits (80), Expect = 0.043 Identities = 13/19 (68%), Positives = 18/19 (94%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 I+CGQV+SA+ PC++YARG Sbjct: 26 ITCGQVNSAVGPCLTYARG 44
>NLTP2_VITSX (P33556) Nonspecific lipid-transfer protein P2 (LTP P2) (Fragment)| Length = 38 Score = 34.3 bits (77), Expect = 0.096 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSSALS C+ Y + GA Sbjct: 2 ITCGQVSSALSSCLGYLKNGGA 23
>NLTP1_VITSX (P80275) Nonspecific lipid-transfer protein P1 (LTP P1) (Fragment)| Length = 38 Score = 34.3 bits (77), Expect = 0.096 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQVSSALS C+ Y + GA Sbjct: 2 ITCGQVSSALSSCLGYLKNGGA 23
>NLTP1_GOSHI (Q42762) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 33.5 bits (75), Expect = 0.16 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++ GQV+++L+PCI+Y RG+GA Sbjct: 24 VTSGQVTNSLAPCINYLRGSGA 45
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 33.5 bits (75), Expect = 0.16 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 +SCGQV S L+PC+ Y +G G Sbjct: 25 LSCGQVQSGLAPCLPYLQGRG 45
>NLTP2_GOSHI (Q43129) Nonspecific lipid-transfer protein precursor (LTP) (GH3)| Length = 120 Score = 33.5 bits (75), Expect = 0.16 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++ GQV+++L+PCI+Y RG+GA Sbjct: 28 VTSGQVTNSLAPCINYLRGSGA 49
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 33.1 bits (74), Expect = 0.21 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+C QVS+ L+PCI+Y R GA Sbjct: 25 ITCSQVSANLAPCINYVRSGGA 46
>NLTP1_TOBAC (Q42952) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Pathogenesis-related protein 14) (PR-14) Length = 114 Score = 32.7 bits (73), Expect = 0.28 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 I+CGQV+S L+PC++Y R G Sbjct: 25 ITCGQVTSNLAPCLAYLRNTG 45
>NLTP1_LYCES (P93224) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 114 Score = 32.3 bits (72), Expect = 0.36 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 +SCG+V+S L+PC+ Y G G Sbjct: 25 LSCGEVTSGLAPCLPYLEGRG 45
>NLTPB_WHEAT (P26913) Probable nonspecific lipid-transfer protein (LTP) (Basic| protein) (WBP) (Fragment) Length = 40 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 98 SCGQVSSALSPCISYARG 151 +CGQV S L+PCISYA G Sbjct: 4 NCGQVVSYLAPCISYAMG 21
>NLTP_PINTA (Q41073) Nonspecific lipid-transfer protein precursor (LTP)| Length = 123 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ISC QV SA++PC +Y GN A Sbjct: 32 ISCNQVVSAMTPCATYLIGNAA 53
>NLTP3_PRUDU (Q43019) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 123 Score = 31.6 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 +SCGQV + L+PCI+Y GA Sbjct: 31 VSCGQVVNNLTPCINYVANGGA 52
>NLTP2_LYCES (P27056) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 31.6 bits (70), Expect = 0.62 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 ++CGQV++ L+PC+ Y +G G Sbjct: 25 LTCGQVTAGLAPCLPYLQGRG 45
>NLTP_SPIOL (P10976) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) Length = 117 Score = 31.6 bits (70), Expect = 0.62 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 I+CG VSS L+PCI Y +G Sbjct: 28 ITCGMVSSKLAPCIGYLKG 46
>NLTP6_GOSHI (O24418) Nonspecific lipid-transfer protein 6 precursor (LTP)| Length = 120 Score = 31.6 bits (70), Expect = 0.62 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGAK 163 IS QV S+L PC+ Y RGN A+ Sbjct: 28 ISYDQVKSSLLPCVGYVRGNNAR 50
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 31.2 bits (69), Expect = 0.81 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 +SCG V+S+++PC+SY G Sbjct: 30 VSCGDVTSSIAPCLSYVMG 48
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 31.2 bits (69), Expect = 0.81 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 ++CGQV S +PCI YA G G Sbjct: 26 VTCGQVVSTWAPCIMYADGEG 46
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 I+CGQV S L+ C+ YAR G Sbjct: 23 ITCGQVDSDLTSCLGYARKGG 43
>NLTP_GERHY (Q39794) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 ISCGQV+S L PC Y G Sbjct: 26 ISCGQVTSGLVPCFGYLAAGG 46
>NLTP_CICAR (O23758) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 30.0 bits (66), Expect = 1.8 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 I+CG+V +AL+PC+ Y +G Sbjct: 25 ITCGRVDTALAPCLGYLQG 43
>NLTP_DAUCA (P27631) Nonspecific lipid-transfer protein precursor (LTP)| (Extracellular protein 2) Length = 120 Score = 30.0 bits (66), Expect = 1.8 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 95 ISCGQVSSALSPCISYAR 148 ++CGQV+ AL+PC+ Y R Sbjct: 28 LTCGQVTGALAPCLGYLR 45
>NLTP1_HORVU (P07597) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Probable amylase/protease inhibitor) Length = 117 Score = 29.6 bits (65), Expect = 2.4 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 ++CGQV S + PC++Y +G Sbjct: 27 LNCGQVDSKMKPCLTYVQG 45
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 I+CG V+S L+PCI Y +G Sbjct: 27 ITCGLVASKLAPCIGYLQG 45
>NLTP4_ARATH (Q9LLR6) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 112 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 I+CG V+S+LSPC+ Y G Sbjct: 25 ITCGTVASSLSPCLGYLSKGG 45
>NLTP_AMACA (P80450) Nonspecific lipid-transfer protein (LTP) (Phospholipid| transfer protein) (PLTP) Length = 94 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++C V+ AL PC++Y +G GA Sbjct: 2 VTCTVVTKALGPCMTYLKGTGA 23
>NLTP1_AMAHP (P83167) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 94 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 ++C V+ AL PC++Y +G GA Sbjct: 2 VTCTVVTKALGPCMTYLKGTGA 23
>NLTP3_VITSX (P80273) Nonspecific lipid-transfer protein P3 (LTP P3) (Fragment)| Length = 37 Score = 28.9 bits (63), Expect = 4.0 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 +SCG V++ ++ CI+Y RG G Sbjct: 1 LSCGDVATQMASCINYLRGAG 21
>NLTP2_BRANA (Q42615) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 117 Score = 28.9 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 +SCG VS ++PCI Y NG Sbjct: 27 LSCGTVSGYVAPCIGYLTQNG 47
>AFP5_MALPA (P83139) Antifungal protein 5 (CW-5) (Fragment)| Length = 38 Score = 28.9 bits (63), Expect = 4.0 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNGA 160 I+CGQV+S ++ C+SY + GA Sbjct: 1 ITCGQVTSQVAGCLSYLQRGGA 22
>NLTP1_WHEAT (P24296) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (ns-LTP1) (Fragment) Length = 113 Score = 28.5 bits (62), Expect = 5.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARG 151 I CG V S + PC+SY +G Sbjct: 24 IDCGHVDSLVRPCLSYVQG 42
>RL28_NEUCR (P08978) 60S ribosomal protein L28 (L27A) (L29) (CRP1)| Length = 149 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 112 HLXAGDGRVGGYEEHGGXQ----GDQHELSSCSASHP 14 H+ AG GRVG + +H G + G H ++ HP Sbjct: 14 HVSAGKGRVGKHRKHPGGRGMAGGQHHHRTNLDKYHP 50
>RL27A_ERYGR (P78987) 60S ribosomal protein L27a (L29)| Length = 149 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 112 HLXAGDGRVGGYEEHGGXQ----GDQHELSSCSASHP 14 H+ AG GRVG + +H G + G H ++ HP Sbjct: 14 HVSAGHGRVGKHRKHPGGRGLAGGQHHHRTNMDKYHP 50
>RL28B_SCHPO (P57728) 60S ribosomal protein L28-B| Length = 148 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 112 HLXAGDGRVGGYEEHGGXQGD----QHELSSCSASHP 14 H+ AG GR+G + +H G +G QH S HP Sbjct: 14 HVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHP 50
>RL28A_SCHPO (P36585) 60S ribosomal protein L28-A (L27A) (L29)| Length = 148 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 112 HLXAGDGRVGGYEEHGGXQGD----QHELSSCSASHP 14 H+ AG GR+G + +H G +G QH S HP Sbjct: 14 HVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHP 50
>NLTP_ARTVU (P0C088) Nonspecific lipid-transfer protein (LTP) (Pollen allergen| Art v 3) (Fragment) Length = 37 Score = 27.7 bits (60), Expect = 9.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 95 ISCGQVSSALSPCISYARGNG 157 ++C VS+ +SPC+SY + G Sbjct: 2 LTCSDVSNKISPCLSYLKQGG 22
>RL28_YEAST (P02406) 60S ribosomal protein L28 (L27A) (L29) (YL24) (RP62)| Length = 148 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -1 Query: 112 HLXAGDGRVGGYEEHGGXQ----GDQHELSSCSASHP 14 H+ AG GR+G + +H G + G+ H + HP Sbjct: 13 HVSAGKGRIGKHRKHPGGRGMAGGEHHHRINMDKYHP 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,824,783 Number of Sequences: 219361 Number of extensions: 70177 Number of successful extensions: 300 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
