Clone Name | basdk08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL253_YEAST (Q06567) ABC1 family protein YLR253W | 34 | 0.11 | 2 | TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53... | 31 | 0.93 | 3 | Y4BJ_RHISN (P55377) Hypothetical 67.9 kDa protein y4bJ | 28 | 6.0 |
---|
>YL253_YEAST (Q06567) ABC1 family protein YLR253W| Length = 569 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 115 DRHSGNLLVRKVGPGSDNFGVQTELIPIDHGL 210 D H GNL +R V P DN E++ DHGL Sbjct: 344 DPHGGNLAIRSVKPAKDNGYHNFEIVLFDHGL 375
>TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53-binding protein| 1) (p53BP1) (53BP1) Length = 1957 Score = 30.8 bits (68), Expect = 0.93 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +1 Query: 61 PVSAVHRIGILDIRIFNTDRHSGNLLVRKVGPGSDNFGVQTELIPIDHGLCLPE 222 P V +L+ N DR S L+ R P N G+QT +DH LC PE Sbjct: 1104 PAEDVMETDLLEGLAANQDRPSKMLMDR---PTQSNIGIQT----VDHSLCAPE 1150
>Y4BJ_RHISN (P55377) Hypothetical 67.9 kDa protein y4bJ| Length = 630 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +1 Query: 112 TDRHSGNLLVRKVGPGSDNFG----VQTELIPIDHGLCLPECLEDPYFEWIH 255 T R +G LL+++V GS++FG + L+ +D + P+ + ++ H Sbjct: 163 TLRRAGRLLIKEVLKGSESFGDNMNAEVRLVWLDRAVAEPQIIFSSHWNGAH 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,965,952 Number of Sequences: 219361 Number of extensions: 903195 Number of successful extensions: 2539 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2539 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)