Clone Name | basdj24 |
---|---|
Clone Library Name | barley_pub |
>KGP2_RAT (Q64595) cGMP-dependent protein kinase 2 (EC 2.7.11.12) (CGK 2)| (cGKII) (Type II cGMP-dependent protein kinase) Length = 762 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 20 PQGQRGNLSRDGLRTEIALLSTPVAARQPGERTRPGH 130 P GQ GNLS + LR+++A L V + + R H Sbjct: 14 PDGQSGNLSNEALRSKVAELEREVKRKDAELQEREYH 50
>CO5A3_HUMAN (P25940) Collagen alpha-3(V) chain precursor| Length = 1745 Score = 28.5 bits (62), Expect = 5.4 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 14 PQPQGQRGNLSRDGLRTEIALLSTPVAARQPGERTRPG 127 P P GQ+GN GL L+ TP PG PG Sbjct: 637 PGPPGQQGNHGSQGLPGPQGLIGTPGEKGPPGNPGIPG 674
>CLR59_PONPY (Q5R686) Cytoplasmic linker protein 170-related 59 kDa protein| (CLIPR-59) (CLIP-170-related 59 kDa protein) Length = 547 Score = 28.5 bits (62), Expect = 5.4 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 Query: 130 VPRPCALPRLTSSNRSRQKGNLSPKPIAREVPTLTLRLGNR 8 VP CALP++T N GNL + L LRLG+R Sbjct: 266 VPLSCALPKVTLPNYDNVPGNLM-------LSALGLRLGDR 299
>CLR59_HUMAN (Q96DZ5) Cytoplasmic linker protein 170-related 59 kDa protein| (CLIPR-59) (CLIP-170-related 59 kDa protein) Length = 547 Score = 28.5 bits (62), Expect = 5.4 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 Query: 130 VPRPCALPRLTSSNRSRQKGNLSPKPIAREVPTLTLRLGNR 8 VP CALP++T N GNL + L LRLG+R Sbjct: 266 VPLSCALPKVTLPNYDNVPGNLM-------LSALGLRLGDR 299
>REEP4_BOVIN (Q3ZCI8) Receptor expression-enhancing protein 4| Length = 257 Score = 28.1 bits (61), Expect = 7.1 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 130 VPRPCALPRLTSSNRSRQKGNLSPKPIAREVPTLTLRLGNRAR 2 VP+P A PR RS+ + KP+ARE + +L++ R + Sbjct: 207 VPQPPARPREKPLGRSQSLRVIKRKPLAREGTSRSLKVRTRKK 249
>DOK3_HUMAN (Q7L591) Docking protein 3 (Downstream of tyrosine kinase 3)| Length = 496 Score = 27.7 bits (60), Expect = 9.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 127 PRPCALPRLTSSNRSRQKGNLSPKPIAREVPT 32 P+PC LPR TS G L P E PT Sbjct: 320 PQPCPLPRATSLPSLDTPGELREMPPGPEPPT 351 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,177,972 Number of Sequences: 219361 Number of extensions: 251209 Number of successful extensions: 1004 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1004 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)