| Clone Name | basdi07 |
|---|---|
| Clone Library Name | barley_pub |
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 32.0 bits (71), Expect = 0.98 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 200 REPLRIFYESLSKQIPSSEMAQFWLMEHGLLSP 298 R P+ +Y++LS I SS + + W H LLSP Sbjct: 2165 RGPVMEWYDALSHHIRSSALVRKWFANHALLSP 2197
>FUS_MEASY (P26032) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 534 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASI (P26031) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 529 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 507 LGGLIGIPALICCCR 521
>FUS_MEASZ (P69358) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASP (P69357) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASL (P69356) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASH (P69355) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASF (P69354) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASE (P69353) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>FUS_MEASA (P35973) Fusion glycoprotein F0 precursor [Contains: Fusion| glycoprotein F2; Fusion glycoprotein F1] Length = 550 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 378 LDALIGVPDLICCCR 334 L LIG+P LICCCR Sbjct: 504 LGGLIGIPALICCCR 518
>NUMA1_HUMAN (Q14980) Nuclear mitotic apparatus protein 1 (NuMA protein) (SP-H| antigen) Length = 2115 Score = 29.3 bits (64), Expect = 6.4 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +2 Query: 164 SLTGQKFETPEEREPLRIFYESLSKQIPSSEMAQFWLMEHGLLSPERAKQAYDRKLKRQQ 343 ++ Q E+ +E + L+ L Q+ E A EH L E+AK YD K ++ Q Sbjct: 1574 AVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAA----EHYKLQMEKAKTHYDAKKQQNQ 1629 Query: 344 QIK 352 +++ Sbjct: 1630 ELQ 1632
>MSH5_MOUSE (Q9QUM7) MutS protein homolog 5| Length = 833 Score = 29.3 bits (64), Expect = 6.4 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +2 Query: 185 ETPEEREPLRIFYESLSKQIPSSEMAQFWLMEHGLLSP--ERAKQAYDRKLKRQQQIKSG 358 ET E+ E L FY+ L + + S+ A + GL P R K+ D I+SG Sbjct: 729 ETCEDGEDLVFFYQ-LCQGVASASHASHTAAQAGLPDPLIARGKEVSDL-------IRSG 780 Query: 359 TPIKASN 379 PIKA+N Sbjct: 781 KPIKATN 787
>DHSB_USTMA (P32420) Succinate dehydrogenase [ubiquinone] iron-sulfur protein,| mitochondrial precursor (EC 1.3.5.1) (IP) Length = 295 Score = 28.9 bits (63), Expect = 8.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +2 Query: 173 GQKFETPEEREPLRIFYESLSKQIPSSEMAQFWLMEHGLLSPERAKQAY 319 G+ ++PEER L YE + S+ +W + L P QAY Sbjct: 177 GEHLQSPEERRRLDGLYECILCACCSTSCPSYWWNQDEYLGPAVLMQAY 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,718,860 Number of Sequences: 219361 Number of extensions: 707094 Number of successful extensions: 2303 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2301 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)