| Clone Name | basdg03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YG4B_YEAST (P46951) Hypothetical 95.4 kDa protein in SNG1-PMT6 i... | 31 | 2.9 | 2 | MATK_VACVI (Q8WIJ9) Maturase K (Intron maturase) | 30 | 3.8 | 3 | RAD17_YEAST (P48581) DNA damage checkpoint control protein RAD17... | 30 | 5.0 |
|---|
>YG4B_YEAST (P46951) Hypothetical 95.4 kDa protein in SNG1-PMT6 intergenic| region Length = 817 Score = 30.8 bits (68), Expect = 2.9 Identities = 13/44 (29%), Positives = 29/44 (65%) Frame = -3 Query: 259 NWIQN*FFVECLLEMNSPASYMSKVIMEYVFLILSKIYFNKLEN 128 N +QN F+ E L +++ + ++ EY+ LI++K+ FN++++ Sbjct: 162 NIMQNVFYKELLAHVDTIPPESNGLLFEYISLIVAKLRFNQIQD 205
>MATK_VACVI (Q8WIJ9) Maturase K (Intron maturase)| Length = 502 Score = 30.4 bits (67), Expect = 3.8 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = -2 Query: 356 DPK*IHLGFFFQHIH*QLRLQVKMNELPNKNSELDPKLIFCGVPTRNE-FSSILYVQGHY 180 DP +HL FF H E PN+NS + PK RN+ F LY ++ Sbjct: 169 DPSSLHLLRFFLH------------EYPNRNSLITPKKYSFSFSKRNQKFFLFLY---NF 213 Query: 179 GVCLFDSVENLFQ*AGKFLCN 117 VC ++S+ + LC+ Sbjct: 214 HVCEYESIFVFLRNQSSHLCS 234
>RAD17_YEAST (P48581) DNA damage checkpoint control protein RAD17 (EC 3.1.11.2)| (DNA repair exonuclease RAD17) Length = 401 Score = 30.0 bits (66), Expect = 5.0 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = -2 Query: 407 YGAGNGNQTRNPNIMSLDPK*IHLGFFFQHIH*QLRLQVKMNELPNKNSELDPKLIFCGV 228 YG GN+T N N++ L+ K ++++ E NKN E + + C Sbjct: 348 YGTDKGNETSNDNLLQLNGK---------------KIKLPSEEENNKNRESEDEENHCKY 392 Query: 227 PTRN 216 PT++ Sbjct: 393 PTKD 396 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,703,549 Number of Sequences: 219361 Number of extensions: 1819608 Number of successful extensions: 3538 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3538 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)