ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | basdf22 |
|---|---|
| Clone Library Name | barley_pub |
>RL27A_OSCBR (O01358) 60S ribosomal protein L27a (Ribosomal protein RPL-27)| Length = 145 Score = 52.8 bits (125), Expect = 2e-07 Identities = 21/41 (51%), Positives = 32/41 (78%) Frame = +2 Query: 11 LVPSDKAAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 LVP ++ + +KAPV+D + GYFKVLGKG+LP++P++V Sbjct: 81 LVPEEQKTKVSAEKAPVIDCVKAGYFKVLGKGLLPKQPLIV 121
>RL27A_ARATH (Q9LR33) 60S ribosomal protein L27a-2| Length = 146 Score = 51.2 bits (121), Expect = 6e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +2 Query: 11 LVPSDKAAEAGGDKAPVVDVSQFGYFKVLGKGMLPE-KPIVV 133 LVP D A++ D P++DV+Q G+FKVLGKG LPE KP VV Sbjct: 81 LVPEDVKAKSSKDNVPLIDVTQHGFFKVLGKGHLPENKPFVV 122
>RL27C_ARATH (P49637) 60S ribosomal protein L27a-3| Length = 146 Score = 50.4 bits (119), Expect = 1e-06 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +2 Query: 11 LVPSDKAAEAGGDKAPVVDVSQFGYFKVLGKGMLPE-KPIVV 133 LVP D A++ D P++DV+Q G+FKVLGKG LPE KP VV Sbjct: 81 LVPEDVKAKSTKDNVPLIDVTQHGFFKVLGKGHLPENKPFVV 122
>RL27A_DROME (P41092) 60S ribosomal protein L27a| Length = 149 Score = 45.4 bits (106), Expect = 3e-05 Identities = 21/44 (47%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = +2 Query: 11 LVPSDKAAEAGGDK---APVVDVSQFGYFKVLGKGMLPEKPIVV 133 LV ++K AE +K APV+D+ +FGY+K+LG+G LP +P++V Sbjct: 82 LVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIV 125
>R27A3_ENTHI (Q9BI14) 60S ribosomal protein L27a-3| Length = 149 Score = 45.1 bits (105), Expect = 4e-05 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = +2 Query: 44 GDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 G++ PV+D + GYFKVLGKG LP++P++V Sbjct: 96 GEEVPVIDCVKHGYFKVLGKGFLPKQPVIV 125
>R27A2_ENTHI (Q9BH80) 60S ribosomal protein L27a-2/4| Length = 149 Score = 45.1 bits (105), Expect = 4e-05 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = +2 Query: 44 GDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 G++ PV+D + GYFKVLGKG LP++P++V Sbjct: 96 GEEVPVIDCVKHGYFKVLGKGFLPKQPVIV 125
>R27A1_ENTHI (Q9BI06) 60S ribosomal protein L27a-1| Length = 149 Score = 45.1 bits (105), Expect = 4e-05 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = +2 Query: 44 GDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 G++ PV+D + GYFKVLGKG LP++P++V Sbjct: 96 GEEVPVIDCVKHGYFKVLGKGFLPKQPVIV 125
>RL27A_TETTH (Q00454) 60S ribosomal protein L27a (L29)| Length = 149 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = +2 Query: 50 KAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 K PV+DV++ G+FKVLGKG LP +P+VV Sbjct: 98 KVPVIDVTKAGFFKVLGKGRLPNQPVVV 125
>RL27A_DICDI (P48160) 60S ribosomal protein L27a| Length = 148 Score = 43.9 bits (102), Expect = 1e-04 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = +2 Query: 11 LVPSD--KAAEAGGD-KAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 LVP K+ A D APVVDV+Q G+FKVLG G+LP +PI+V Sbjct: 81 LVPESVRKSLAAKNDGTAPVVDVTQKGFFKVLGHGILPTQPIIV 124
>RL27A_EUPCR (P48161) 60S ribosomal protein L27a (L29)| Length = 148 Score = 43.5 bits (101), Expect = 1e-04 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = +2 Query: 11 LVPSDKAAEAGGDKAPVV--DVSQFGYFKVLGKGMLPEKPIVV 133 LV ++ +A DK+ V+ DV + GY+KVLGKG+LPE P+VV Sbjct: 81 LVTEEERQKAQTDKSKVILIDVVKHGYYKVLGKGLLPEVPLVV 123
>RL27A_RAT (P18445) 60S ribosomal protein L27a| Length = 147 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 29 AAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 AA+ AP++DV + GY+KVLGKG LP++P++V Sbjct: 89 AAKNKNGVAPIIDVVRSGYYKVLGKGKLPKQPVIV 123
>RL27A_PONPY (Q5REY2) 60S ribosomal protein L27a| Length = 147 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 29 AAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 AA+ AP++DV + GY+KVLGKG LP++P++V Sbjct: 89 AAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIV 123
>RL27A_PANTR (Q5R1X0) 60S ribosomal protein L27a| Length = 147 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 29 AAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 AA+ AP++DV + GY+KVLGKG LP++P++V Sbjct: 89 AAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIV 123
>RL27A_HUMAN (P46776) 60S ribosomal protein L27a| Length = 147 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 29 AAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 AA+ AP++DV + GY+KVLGKG LP++P++V Sbjct: 89 AAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIV 123
>RL27A_MOUSE (P14115) 60S ribosomal protein L27a (L29)| Length = 147 Score = 42.7 bits (99), Expect = 2e-04 Identities = 16/27 (59%), Positives = 24/27 (88%) Frame = +2 Query: 53 APVVDVSQFGYFKVLGKGMLPEKPIVV 133 AP++DV + GY+KVLGKG LP++P++V Sbjct: 97 APIIDVVRSGYYKVLGKGKLPKQPVIV 123
>RL28A_SCHPO (P36585) 60S ribosomal protein L28-A (L27A) (L29)| Length = 148 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = +2 Query: 23 DKAAEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 DK + APV++V Q GY KVLGKG LPE P++V Sbjct: 88 DKYLGKNTEVAPVINVLQSGYGKVLGKGRLPETPVIV 124
>RL27A_XENLA (P47830) 60S ribosomal protein L27a (L22)| Length = 147 Score = 40.8 bits (94), Expect = 8e-04 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +2 Query: 53 APVVDVSQFGYFKVLGKGMLPEKPIVV 133 AP++D GY+KVLGKG LP++P++V Sbjct: 97 APIIDAVHAGYYKVLGKGKLPKQPVIV 123
>RL28_YEAST (P02406) 60S ribosomal protein L28 (L27A) (L29) (YL24) (RP62)| Length = 148 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Frame = +2 Query: 11 LVPSDKAAE----AGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 L+P DK + A + APV+D GY K+LGKG +P P++V Sbjct: 80 LIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIPNVPVIV 124
>RL28B_SCHPO (P57728) 60S ribosomal protein L28-B| Length = 148 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Frame = +2 Query: 11 LVPSDKAAEAGG---DKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 LVP++ + G + APV++V Q GY KVLGKG LP+ P+++ Sbjct: 81 LVPNETREKYLGKNTEVAPVINVLQSGYGKVLGKGRLPDTPVII 124
>RL28_NEUCR (P08978) 60S ribosomal protein L28 (L27A) (L29) (CRP1)| Length = 149 Score = 40.4 bits (93), Expect = 0.001 Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +2 Query: 11 LVPSDKAAE----AGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 LVP++ + A + APV+D+ GY K+LGKG LP+ PIVV Sbjct: 81 LVPAEAREKYVSGAATETAPVIDLLSHGYAKLLGKGRLPQVPIVV 125
>RL28_CANAL (P47831) 60S ribosomal protein L28 (L27A) (L29) (Fragment)| Length = 62 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 32 AEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 +++ APV+D GY KVLGKG LPE P++V Sbjct: 8 SKSSASAAPVIDTLAHGYGKVLGKGRLPEVPVIV 41
>RL27A_ERYGR (P78987) 60S ribosomal protein L27a (L29)| Length = 149 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Frame = +2 Query: 11 LVPSDKA----AEAGGDKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 L+P++K + D PV+D+ GY KVLGKG +P+ P+VV Sbjct: 81 LIPAEKREAYLSSTNPDVIPVIDLLPLGYSKVLGKGRIPKVPLVV 125
>RL27A_ENCCU (O62581) 60S ribosomal protein L27a| Length = 147 Score = 34.7 bits (78), Expect = 0.060 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +2 Query: 47 DKAPVVDVSQFGYFKVLGKGMLPEKPIVV 133 +K PV+DV +FGY V+G + E+PIVV Sbjct: 95 EKVPVIDVREFGYHVVVGGKLSLERPIVV 123
>RL27A_TENMO (Q27021) 60S ribosomal protein L27a| Length = 148 Score = 32.3 bits (72), Expect = 0.30 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 50 KAPVVDVSQFGYFKVLGKG 106 KAPV+D+ + GY+K+LGKG Sbjct: 97 KAPVIDIVKAGYYKLLGKG 115
>RL27A_TRYBB (O15883) 60S ribosomal protein L27a (L29)| Length = 145 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 11 LVPSDKAAEAG-GDKAPVVDVSQFGYFKVLGKGMLPEKPIV 130 L+ D+A +A G+ PV+D+ GY K+LG G L IV Sbjct: 81 LMAKDEAMKAKKGEVLPVIDLLANGYSKLLGNGHLQAPCIV 121
>NAL14_HUMAN (Q86W24) NACHT-, LRR- and PYD-containing protein 14| (Nucleotide-binding oligomerization domain protein 5) Length = 1093 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 174 LIFFSAILEMSLALTTMGFSGSIPLPSTLK*PNCE 70 LI +++M+L T+G+ G + L LK P C+ Sbjct: 1010 LICNKRLIKMNLTQNTLGYEGIVKLYKVLKSPKCK 1044
>RL15_METJA (P54047) 50S ribosomal protein L15P| Length = 143 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 59 VVDVSQFGYFKVLGKGMLPEKPIV 130 VVDV + GY KVLGKG + IV Sbjct: 97 VVDVIELGYEKVLGKGKVTIPMIV 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,135,224 Number of Sequences: 219361 Number of extensions: 376461 Number of successful extensions: 796 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
