Clone Name | basde08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZIPA_SALTY (P0A2N6) Cell division protein zipA homolog | 30 | 4.9 | 2 | ZIPA_SALTI (P0A2N7) Cell division protein zipA homolog | 30 | 4.9 | 3 | SERI1_BOMMO (P07856) Sericin 1 precursor (Silk gum protein) | 30 | 8.4 |
---|
>ZIPA_SALTY (P0A2N6) Cell division protein zipA homolog| Length = 328 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 394 PPSR*PEDGARPGDGPSA--LQEAPAVHQEEPILQEFP 501 PPS+ P+ A+P PSA Q A V + EP+++E P Sbjct: 146 PPSQAPQPVAQPAPPPSAQTFQPAEPVVEAEPVVEEAP 183
>ZIPA_SALTI (P0A2N7) Cell division protein zipA homolog| Length = 328 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 394 PPSR*PEDGARPGDGPSA--LQEAPAVHQEEPILQEFP 501 PPS+ P+ A+P PSA Q A V + EP+++E P Sbjct: 146 PPSQAPQPVAQPAPPPSAQTFQPAEPVVEAEPVVEEAP 183
>SERI1_BOMMO (P07856) Sericin 1 precursor (Silk gum protein)| Length = 1186 Score = 29.6 bits (65), Expect = 8.4 Identities = 27/78 (34%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = -3 Query: 630 YRGSSIPSKXRKQNTDRHGHGY*NRQMTSGRTMVYGFVSSWAGGKFLKNGFFLMNGRSFL 451 +RG S+ S NTD TSG + YG+ SS GG G N S Sbjct: 625 HRGGSVSSTGSSSNTDSSTKNA--GSSTSGGSSTYGYSSSHRGGSVSSTG-SSSNTDSST 681 Query: 450 KS*GSVS--GSCTIFWSA 403 KS GS + GS T +S+ Sbjct: 682 KSAGSSTSGGSSTYGYSS 699 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,700,864 Number of Sequences: 219361 Number of extensions: 1035687 Number of successful extensions: 2783 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2780 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)