Clone Name | basdb22 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | E74EF_DROVI (Q7M3M6) Ecdysone-induced protein 74EF (ETS-related ... | 31 | 2.7 | 2 | E74EB_DROME (P11536) Ecdysone-induced protein 74EF isoform B (ET... | 30 | 6.0 | 3 | E74EA_DROME (P20105) Ecdysone-induced protein 74EF isoform A (ET... | 30 | 6.0 |
---|
>E74EF_DROVI (Q7M3M6) Ecdysone-induced protein 74EF (ETS-related protein E74A)| Length = 873 Score = 30.8 bits (68), Expect = 2.7 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +2 Query: 11 APAKATWSSYWNLASGNWIEPNILQNNAASN-RSAWFQIHQVNDSFAIRSVSS 166 A A A ++ +L +G ++ PN+ QNNAA++ R+ W + V D++ S SS Sbjct: 516 AAAAAAAAAAAHLHTGTFLHPNLYQNNAANSLRNIWNRSVGVPDNYYGNSGSS 568
>E74EB_DROME (P11536) Ecdysone-induced protein 74EF isoform B (ETS-related| protein E74B) Length = 883 Score = 29.6 bits (65), Expect = 6.0 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +2 Query: 11 APAKATWSSYWNLASGNWIEPNILQNNAASN-RSAWFQIHQVNDSF 145 A A A ++ +L +G ++ PN+ QNNAA++ R+ W + V D++ Sbjct: 514 AAAAAAAAAAAHLHTGTFLHPNLYQNNAANSLRNIWNRSVGVPDNY 559
>E74EA_DROME (P20105) Ecdysone-induced protein 74EF isoform A (ETS-related| protein E74A) Length = 829 Score = 29.6 bits (65), Expect = 6.0 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +2 Query: 11 APAKATWSSYWNLASGNWIEPNILQNNAASN-RSAWFQIHQVNDSF 145 A A A ++ +L +G ++ PN+ QNNAA++ R+ W + V D++ Sbjct: 460 AAAAAAAAAAAHLHTGTFLHPNLYQNNAANSLRNIWNRSVGVPDNY 505 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,601,589 Number of Sequences: 219361 Number of extensions: 927013 Number of successful extensions: 3076 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3076 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)