| Clone Name | basdb03 |
|---|---|
| Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 46.6 bits (109), Expect = 5e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +2 Query: 170 KCCNNCR-SFSGVDVCDDAHPQCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 337 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 338 C 340 C Sbjct: 102 C 102
>PRIA_RICCN (Q92HH1) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 648 Score = 33.9 bits (76), Expect = 0.37 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 92 WCSSWLPMNSLSAKLELYLCGXSGRMLSSC 3 +CSSW+ ++ + KLE + CG ++ SSC Sbjct: 369 FCSSWMVVHKATKKLECHHCGYQSKIFSSC 398
>PRIA_RICPR (Q9ZD10) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 648 Score = 33.1 bits (74), Expect = 0.63 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 92 WCSSWLPMNSLSAKLELYLCGXSGRMLSSC 3 +CS+W+ ++ + KLE + CG ++ SSC Sbjct: 369 FCSAWMVLHKATKKLECHHCGYQSKIFSSC 398
>PRIA_RICTY (Q68WJ4) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 648 Score = 30.8 bits (68), Expect = 3.1 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 92 WCSSWLPMNSLSAKLELYLCGXSGRMLSSC 3 +CS+W+ ++ + LE + CG ++ SSC Sbjct: 369 FCSAWMVLHKATKTLECHHCGYQSKIFSSC 398
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 30.4 bits (67), Expect = 4.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -2 Query: 327 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHWGWASSQTST 202 Q+P T +FMSA N L TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 30.0 bits (66), Expect = 5.3 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +2 Query: 173 CCNNCRSFSGVD-----VCDDAHPQCPKGCSACRVVTPSPHKTFRCAD 301 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 29.6 bits (65), Expect = 6.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 383 VPPRIKLR*DEQSSCCYVCVWAVLYGQQYVRCLSSLC 493 +PPR++ +EQ S C +C+ + + +C S C Sbjct: 149 LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFC 185
>ACOT3_MOUSE (Q9QYR7) Acyl-coenzyme A thioesterase 3 (EC 3.1.2.2) (Acyl-CoA| thioesterase 3) (Peroxisomal acyl-coenzyme A thioester hydrolase 2a) (Peroxisomal long-chain acyl-coA thioesterase 2) (PTE-Ia) Length = 432 Score = 29.6 bits (65), Expect = 6.9 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = -2 Query: 576 FMFLMSR--HAQPSEVFIQQATPAFSRERKHSDDKQRTYCWPYSTAHTQT*QHDDCSSHL 403 F+FL+ + H SE + ++A+ R + H +K + C+P + H + C + L Sbjct: 329 FLFLVGQDDHNWKSEFYAREAS---KRLQAHGKEKPQIICYPETGHHIEPPYFPLCKASL 385 Query: 402 SFILGG 385 + ++GG Sbjct: 386 NSLVGG 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,223,443 Number of Sequences: 219361 Number of extensions: 1271258 Number of successful extensions: 3266 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3261 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)