Clone Name | basda08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-as... | 32 | 1.2 | 2 | GPR20_HUMAN (Q99678) Probable G-protein coupled receptor 20 | 30 | 4.5 | 3 | HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72) | 30 | 7.7 |
---|
>KR151_CAPHI (Q6R645) Keratin-associated protein 15-1 (Keratin-associated| protein 15.1) Length = 136 Score = 32.3 bits (72), Expect = 1.2 Identities = 22/52 (42%), Positives = 25/52 (48%) Frame = -1 Query: 497 PCQSHYTSALKSGNIGQTKGKYIYMSTSVQVTDASKYCHHRQNRCSPTMTSS 342 PCQ+ YT +L SGNIG G + ST Q N CSPT SS Sbjct: 85 PCQTIYTGSLGSGNIG--LGSFGCGSTGFQSLGCG------SNFCSPTYVSS 128
>GPR20_HUMAN (Q99678) Probable G-protein coupled receptor 20| Length = 358 Score = 30.4 bits (67), Expect = 4.5 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 7 TRRKPC*RSCCLQRWKTILPKRVLRVALFWFVCALRRPGLL*Q 135 T +PC R L + +LP V+ V +CAL RPGLL Q Sbjct: 189 TGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQ 231
>HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72)| Length = 644 Score = 29.6 bits (65), Expect = 7.7 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 107 HYGGRDFYDSSPHKQANESSRNYKEDNTDGSLATR 211 H GG DF + + ANE R YK+D T A R Sbjct: 226 HLGGEDFDNRLVNHFANEFKRKYKKDLTTNQRALR 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,779,105 Number of Sequences: 219361 Number of extensions: 2075387 Number of successful extensions: 5588 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5585 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)