Clone Name | basda07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72) | 30 | 4.4 | 2 | YANB_SCHPO (Q10076) Hypothetical zinc finger protein C3H1.11 in ... | 29 | 5.7 | 3 | CPB3_CAEEL (O01835) Cytoplasmic polyadenylation element-binding ... | 29 | 7.5 | 4 | IF2_BUCAP (Q8K9H1) Translation initiation factor IF-2 | 28 | 9.7 |
---|
>HSP71_PICAN (P53421) Heat-shock protein 70 1 (HSP72)| Length = 644 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 71 HYGGRDFYDSSPHKQANESSRNYKEDNTDGSLATR 175 H GG DF + + ANE R YK+D T A R Sbjct: 226 HLGGEDFDNRLVNHFANEFKRKYKKDLTTNQRALR 260
>YANB_SCHPO (Q10076) Hypothetical zinc finger protein C3H1.11 in chromosome I| Length = 582 Score = 29.3 bits (64), Expect = 5.7 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -1 Query: 325 APXXXXLFMPDDSCQLYSLPARPAPFYSLFTIGESTAKYLVVQ*TLPPITS 173 AP +P +SC+ YSLP+ P+ S+ Y+ Q PP+ S Sbjct: 27 APAQSSSPLPSNSCREYSLPSHPSTH-------NSSVAYVDSQDNKPPLVS 70
>CPB3_CAEEL (O01835) Cytoplasmic polyadenylation element-binding protein 3| Length = 751 Score = 28.9 bits (63), Expect = 7.5 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +2 Query: 5 TKYGKQFYPNESS----ESPYFGSSVHYGGRDFYDSSPHKQANESSRNY 139 T YG +P S+ + PY+G++++YG F H A S NY Sbjct: 704 TYYGSPNHPTSSNISQPQQPYYGANLYYG---FIPPQQHPSAMMRSPNY 749
>IF2_BUCAP (Q8K9H1) Translation initiation factor IF-2| Length = 867 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +2 Query: 2 LTKYGKQFYPNESSESPYFGSSVHYGGRDFYDSSPHKQANESSRNYKEDNTDGSLAT 172 L K K N++ ++ ++++ FY K E+ + YKE+ D L T Sbjct: 150 LNKLTKSNVFNKNEKNKSLKKNINFNNHSFYSKKTIKNNTENQKLYKEEKKDYHLTT 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,645,674 Number of Sequences: 219361 Number of extensions: 1532539 Number of successful extensions: 4103 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4102 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)