| Clone Name | basda05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GIDB_RHOPA (Q6ND16) Methyltransferase gidB (EC 2.1.-.-) (Glucose... | 31 | 2.1 | 2 | GIDB_BRAJA (Q89WP6) Methyltransferase gidB (EC 2.1.-.-) (Glucose... | 31 | 2.1 | 3 | PPIB_TREPA (O66105) Probable peptidyl-prolyl cis-trans isomerase... | 30 | 4.7 |
|---|
>GIDB_RHOPA (Q6ND16) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 223 Score = 30.8 bits (68), Expect = 2.1 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -3 Query: 252 WRARVRMVKAAKKRMVWTKM---ALPLVWRPPKSTRWCDPGISNSSPGV 115 W+A+ +V + +WT+ +L LV P + RW D G PGV Sbjct: 45 WQAKTNLVAPSTLPQLWTRHVADSLQLVSLMPHARRWLDFGSGGGFPGV 93
>GIDB_BRAJA (Q89WP6) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 260 Score = 30.8 bits (68), Expect = 2.1 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -3 Query: 252 WRARVRMVKAAKKRMVWTKM---ALPLVWRPPKSTRWCDPGISNSSPGV 115 W+A+ +V + +WT+ +L LV P + RW D G PGV Sbjct: 83 WQAKTNLVAPSTLPHLWTRHIADSLQLVDLAPTARRWADLGSGGGFPGV 131
>PPIB_TREPA (O66105) Probable peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) Length = 215 Score = 29.6 bits (65), Expect = 4.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 150 CDPGISNSSPGVSRMKSTTPTTTGPQ 73 CDP + + SPGV M + P T G Q Sbjct: 119 CDPALRHDSPGVLSMANAGPGTNGSQ 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,436,461 Number of Sequences: 219361 Number of extensions: 734093 Number of successful extensions: 2492 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2436 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)