Clone Name | bah63p11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | AKA11_RAT (Q62924) A-kinase anchor protein 11 (Protein kinase A-... | 32 | 1.1 | 2 | DEF2_COREF (Q8FMD0) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) ... | 31 | 3.2 |
---|
>AKA11_RAT (Q62924) A-kinase anchor protein 11 (Protein kinase A-anchoring| protein 11) (PRKA11) (A-kinase anchor protein 220 kDa) (AKAP 220) Length = 1129 Score = 32.3 bits (72), Expect = 1.1 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = -2 Query: 453 LEHFLIGVSHYLSNQGLGVDCADRIGEASGRRRTPPYQGHRCRYVACNQTQHFSPHGQCA 274 L+ F + SH +N+ L + E +R+ Y H C+Y C++TQ + Sbjct: 651 LKLFPMHTSHVKTNKELLFSSKEHHQEVDKKRQRKKYGSHPCKYQTCDRTQDPCRNELSE 710 Query: 273 RLRFSA 256 RFSA Sbjct: 711 LYRFSA 716
>DEF2_COREF (Q8FMD0) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 193 Score = 30.8 bits (68), Expect = 3.2 Identities = 19/78 (24%), Positives = 34/78 (43%) Frame = +1 Query: 262 EAKPSALSMWTKMLGLVAGNISAAMALIRGSAAASRCFSDSVGTVNPEALVGQIVGHADQ 441 E P+ + W K+ GL N + G+ +RCF VG ++ ++G + Sbjct: 106 EGFPTGRADWAKVTGL---NEDGEEWSMEGTGFLARCFQHEVGHLDGVVYTDTLIGRWKR 162 Query: 442 EVFKTITSSYYLLAGSSW 495 KTI ++ + G +W Sbjct: 163 LAKKTIKANGWTEPGLTW 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,284,756 Number of Sequences: 219361 Number of extensions: 1674584 Number of successful extensions: 4861 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4860 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)