Clone Name | bah63l09 |
---|---|
Clone Library Name | barley_pub |
>RS5A_DROME (Q24186) 40S ribosomal protein S5a| Length = 228 Score = 31.6 bits (70), Expect = 1.6 Identities = 22/68 (32%), Positives = 31/68 (45%) Frame = +2 Query: 131 IQSTDEFPFLDPNLYWSCSTSTVDD**VRRRFPLREEFADGLEHSDLVAHCRAAAGRTGG 310 + ST E P + WSC TV+D ++ ++E+FA L HS AGR Sbjct: 32 VVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHS---------AGRYAA 82 Query: 311 KSGRGVEC 334 K R +C Sbjct: 83 KRFRKAQC 90
>PTN1_MOUSE (P35821) Tyrosine-protein phosphatase non-receptor type 1 (EC| 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B) (Protein-protein-tyrosine phosphatase HA2) (PTP-HA2) Length = 432 Score = 31.2 bits (69), Expect = 2.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 224 FPLREEFADGLEHSDLVAHCRAAAGRTG 307 F +RE + LEH +V HC A GR+G Sbjct: 196 FKVRESGSLSLEHGPIVVHCSAGIGRSG 223
>CAC1H_MOUSE (O88427) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) Length = 2365 Score = 29.6 bits (65), Expect = 6.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 344 PRSGIRLLDRFCLRSSPPRHGNGPPD 267 P +G L R C+ SPP G+GPPD Sbjct: 544 PGAGDTRLVRACVPPSPPSPGHGPPD 569
>DXR_XANAC (Q8PML1) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC| 1.1.1.267) (DXP reductoisomerase) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) Length = 396 Score = 29.3 bits (64), Expect = 8.0 Identities = 24/74 (32%), Positives = 30/74 (40%), Gaps = 17/74 (22%) Frame = -1 Query: 311 CLRSSPPRHG--------NGPPDLSVRGRRRTPLAAETCAVLINHPRW---------MCC 183 CLRS G +G P RGR R LAA T A + HP+W Sbjct: 164 CLRSCDASRGVRRVILTASGGP---FRGRDRAALAAVTPAQAVAHPKWSMGPKISVDSAT 220 Query: 182 MTSKGLDQERGTHL 141 + +KGL+ HL Sbjct: 221 LMNKGLEVIEAHHL 234
>CAC1H_RAT (Q9EQ60) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) Length = 2359 Score = 29.3 bits (64), Expect = 8.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 344 PRSGIRLLDRFCLRSSPPRHGNGPPD 267 P +G L R C SPP G+GPPD Sbjct: 544 PGAGDNRLVRACAPPSPPSPGHGPPD 569 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,211,890 Number of Sequences: 219361 Number of extensions: 1733335 Number of successful extensions: 4869 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4869 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)