Clone Name | bah63i12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y964_METJA (Q58374) Hypothetical protein MJ0964 | 33 | 0.57 | 2 | UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Unco... | 31 | 3.7 | 3 | RPOA_LDVC (Q06502) Replicase polyprotein 1ab (ORF1ab polyprotein... | 30 | 4.8 |
---|
>Y964_METJA (Q58374) Hypothetical protein MJ0964| Length = 680 Score = 33.5 bits (75), Expect = 0.57 Identities = 18/64 (28%), Positives = 37/64 (57%) Frame = +2 Query: 443 RFDAIGQLKEFPCVSLSSTEESRRIDEVAKPRKEYQDTPMMYVEACENHVHAKKKIQVLS 622 R DA G + ++ + EE ++I E+ K +K+Y+ + ++ + +N +H KK +++ Sbjct: 128 RIDANGNI-----ITPLNEEELQKIAEIIK-KKDYEVVVISFLHSYKNPIHEKKAREIIK 181 Query: 623 NGCS 634 N CS Sbjct: 182 NLCS 185
>UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Uncoordinated protein| 89) Length = 8081 Score = 30.8 bits (68), Expect = 3.7 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 27 DP-PPXXWFRRILWLQDLPNTVLKAMPCSCNVFIVSRHRLTIKLVNQTQADNSNTYLKIE 203 DP P W+R L++ P TV++ P V+ ++ + + + +A+N++ K + Sbjct: 5513 DPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQ 5572 Query: 204 SVSHREFAL 230 + +H + AL Sbjct: 5573 ATAHVQMAL 5581
>RPOA_LDVC (Q06502) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3637 Score = 30.4 bits (67), Expect = 4.8 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -3 Query: 645 CKSSLHPLESTWI-FFL----AWT*FSQASTYIIGVSWYSFLGFATSSI 514 CK SLHP+ W+ FFL W AS ++ SW FL ATSS+ Sbjct: 1411 CKVSLHPITLVWVQFFLLAVNVWA--GVASVVVLISSW--FLARATSSL 1455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,359,138 Number of Sequences: 219361 Number of extensions: 1538179 Number of successful extensions: 3609 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3609 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)