| Clone Name | bah62p15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NDUB2_MOUSE (Q9CPU2) NADH dehydrogenase [ubiquinone] 1 beta subc... | 32 | 1.6 | 2 | RFC1_SCHPO (O60182) Probable activator 1 subunit 1 (Replication ... | 31 | 2.0 |
|---|
>NDUB2_MOUSE (Q9CPU2) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit| 2, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (NADH-ubiquinone oxidoreductase AGGG subunit) (Complex I-AGGG) (CI-AGGG) Length = 105 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 96 PHNKRWHTVAGKGLCAVMWFWIFYRAKQDGAVLLG 200 P R + G+ L ++MWFWI +R D +LG Sbjct: 48 PQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLG 82
>RFC1_SCHPO (O60182) Probable activator 1 subunit 1 (Replication factor C| subunit 1) (Replication factor C1) Length = 934 Score = 31.2 bits (69), Expect = 2.0 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 322 IVLHVSTRVSANKSTTICHFIPVLFES--VNLFSTQTDFVAGLL 447 I +H+ +VSANK H+IP+L+ES V L + +D V ++ Sbjct: 753 IQVHMRLKVSANKLDLRQHYIPILYESLPVKLSTGHSDVVPEII 796 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,234,533 Number of Sequences: 219361 Number of extensions: 818638 Number of successful extensions: 1770 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1768 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)