Clone Name | bah62p10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1000_PSEAE (P20581) Hypothetical protein PA1000 | 30 | 3.7 | 2 | RPOC_AGRT5 (Q8UE09) DNA-directed RNA polymerase beta' chain (EC ... | 30 | 3.7 | 3 | TIP60_DROME (Q960X4) Histone acetyltransferase Tip60 (EC 2.3.1.48) | 29 | 4.8 | 4 | RPOC_RHIME (Q92QH6) DNA-directed RNA polymerase beta' chain (EC ... | 29 | 6.3 | 5 | CLF1_CANAL (Q5AED6) Pre-mRNA-splicing factor CLF1 | 28 | 8.2 |
---|
>Y1000_PSEAE (P20581) Hypothetical protein PA1000| Length = 301 Score = 29.6 bits (65), Expect = 3.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 56 MERTQRLPLKLNCNLKHQSLRNGRVNQEG-QSRFVQCLKMLK 178 +ER QRLP L H L GR+ +G +S + +CL++ + Sbjct: 205 LERLQRLPTLLQLIPGHGGLLRGRLAADGAESAYTECLRLCR 246
>RPOC_AGRT5 (Q8UE09) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1402 Score = 29.6 bits (65), Expect = 3.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = +2 Query: 197 LMKRMMIRKIQLLLVVHGRG---ALLDQRSVRKMKKLVKHNLKVFQLAGSLVRGGSHLA 364 + R ++R + +L+ GR +LD+R V + + V + K+F G V+ G LA Sbjct: 956 IKNRNILRNSEGVLIAMGRNMSVTILDERGVERSSQRVAYGSKIFVDDGDKVKRGQRLA 1014
>TIP60_DROME (Q960X4) Histone acetyltransferase Tip60 (EC 2.3.1.48)| Length = 541 Score = 29.3 bits (64), Expect = 4.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 91 IQLQGQPLSPFHFGPQRQLLCQLPC 17 I+L + P++F P Q LCQ+PC Sbjct: 263 IELGRHRIKPWYFSPYPQELCQMPC 287
>RPOC_RHIME (Q92QH6) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1401 Score = 28.9 bits (63), Expect = 6.3 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +2 Query: 197 LMKRMMIRKIQLLLVVHGRGA---LLDQRSVRKMKKLVKHNLKVFQLAGSLVRGGSHLA 364 + R M+R +LV GR +LD+R V + + V + K+F G V+ G A Sbjct: 955 IKNRNMLRNSDGVLVAMGRNMAIQILDERGVERSSQRVAYGSKIFVDDGDKVKRGQRFA 1013
>CLF1_CANAL (Q5AED6) Pre-mRNA-splicing factor CLF1| Length = 758 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 148 SVRAVLEDAKVVLGGNFDEKNDDQEDSVTV 237 +VRAV E A L N E+NDD E+ T+ Sbjct: 275 TVRAVFESAVDTLLSNKSEENDDDEEFATI 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,738,209 Number of Sequences: 219361 Number of extensions: 1024571 Number of successful extensions: 1886 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1886 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)