| Clone Name | bah62n05 |
|---|---|
| Clone Library Name | barley_pub |
>Y1770_SYNY3 (P73627) Hypothetical protein sll1770| Length = 585 Score = 34.7 bits (78), Expect = 0.22 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 530 MGATYIKLGQFIASAPTFFPAEYVEE 607 +G T+IK+GQ ++ FPAEYVEE Sbjct: 95 LGPTFIKVGQLFSTRSDLFPAEYVEE 120
>YHG1_CLOPA (Q46189) Hypothetical protein in hydrogenase 1 5'region (Fragment)| Length = 530 Score = 34.7 bits (78), Expect = 0.22 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 521 FERMGATYIKLGQFIASAPTFFPAEYVEE 607 FE +G T+IK+GQ +++ P P Y++E Sbjct: 40 FEELGPTFIKIGQILSTRPDLLPLPYIKE 68
>KIF1C_MOUSE (O35071) Kinesin-like protein KIF1C| Length = 1100 Score = 30.8 bits (68), Expect = 3.2 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 275 PGRSSARKP*PLPGPVVSYP-VRPRARPPSANLPHR 171 PG S P P P V+ P P RPPS PHR Sbjct: 991 PGMGSGEAPAPQPPEEVTVPPAPPNRRPPSPRRPHR 1026
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 30.4 bits (67), Expect = 4.2 Identities = 21/56 (37%), Positives = 25/56 (44%) Frame = -3 Query: 528 RSKSLLR*RGESKPSRI*AGIPSDVLAVFEKSFSHSPPTPRRTWIPCPILKTPRGP 361 RS SL R R S P R + P ++ +S SPP RRT P P K P Sbjct: 565 RSPSLPRRRSPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASP 620
>Y095_SYNY3 (Q55884) Hypothetical protein sll0095| Length = 567 Score = 30.4 bits (67), Expect = 4.2 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 530 MGATYIKLGQFIASAPTFFPAEYVE 604 +G T+IK+GQ +++ PAEY+E Sbjct: 68 LGPTFIKIGQSLSTRADIIPAEYIE 92
>KIF1C_RAT (O35787) Kinesin-like protein KIF1C (Kinesin-like protein KIF1D)| Length = 1097 Score = 30.0 bits (66), Expect = 5.5 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 275 PGRSSARKP*PLPGP-VVSYPVRPRARPPSANLPHR 171 PG S P P P V + P P RPPS PHR Sbjct: 988 PGMGSGEAPGPQPPEEVTAPPPPPNRRPPSPRRPHR 1023
>ULE1B_HUMAN (Q9UBT2) Ubiquitin-like 1-activating enzyme E1B (SUMO-1-activating| enzyme subunit 2) (Anthracycline-associated resistance ARX) Length = 640 Score = 29.6 bits (65), Expect = 7.2 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -3 Query: 426 HSPPTPRRTWIPCPILKTPRGPVLIDVWRRSSTN--FGNSPA---LSWSRLEKSCAWE 268 H PT +RT+ C I TP P+ VW + N FG A +S R + AWE Sbjct: 162 HPKPT-QRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWE 218
>ULE1B_MOUSE (Q9Z1F9) Ubiquitin-like 1-activating enzyme E1B (SUMO-1-activating| enzyme subunit 2) (Anthracycline-associated resistance ARX) Length = 638 Score = 29.6 bits (65), Expect = 7.2 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = -3 Query: 426 HSPPTPRRTWIPCPILKTPRGPVLIDVWRRSSTN--FGNSPA---LSWSRLEKSCAWE 268 H PT +RT+ C I TP P+ VW + N FG A +S R + AWE Sbjct: 162 HPKPT-QRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWE 218
>PAN2_YEAST (P53010) PAB-dependent poly(A)-specific ribonuclease subunit PAN2| (EC 3.1.13.4) (PAB1P-dependent poly(A)-nuclease) Length = 1115 Score = 29.3 bits (64), Expect = 9.4 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 16/56 (28%) Frame = -3 Query: 423 SPPTPRRTWI-PCPILK----TPRGPVL--------IDVWRRSSTNFG---NSPAL 304 S PT R ++ PC +K +P G VL +D WRRSS N G N+P + Sbjct: 285 SNPTLRTQYVHPCQSIKKLCLSPNGDVLGILEADNHLDTWRRSSNNMGMFTNTPEM 340
>TNFL6_FELCA (Q861W5) Tumor necrosis factor ligand superfamily member 6 (Fas| antigen ligand) (Fas ligand) (CD178 antigen) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, solub Length = 280 Score = 29.3 bits (64), Expect = 9.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 284 SLVPGRSSARKP*PLPGPVVSYPVRPRARPP 192 S VPGR R+P P P P + P P PP Sbjct: 34 SSVPGRPGQRRPPPPPPPTLPPPPPPPPLPP 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,859,067 Number of Sequences: 219361 Number of extensions: 1164825 Number of successful extensions: 3212 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3177 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)