Clone Name | bah62l06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DMP1_BOVIN (Q95120) Dentin matrix acidic phosphoprotein 1 precur... | 33 | 0.87 | 2 | SL9A1_CRIGR (P48761) Sodium/hydrogen exchanger 1 (Na(+)/H(+) exc... | 31 | 2.5 | 3 | PNP_HAEIN (P44584) Polyribonucleotide nucleotidyltransferase (EC... | 30 | 5.6 | 4 | YABR_BACSU (P37560) Hypothetical protein yabR | 30 | 7.3 | 5 | TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein | 30 | 7.3 |
---|
>DMP1_BOVIN (Q95120) Dentin matrix acidic phosphoprotein 1 precursor (Dentin| matrix protein 1) (DMP-1) Length = 510 Score = 32.7 bits (73), Expect = 0.87 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 367 DDKLVESPTEVESKEDSSSTEAVTGAVEPPTVSATEVESKE 489 +D +S SKEDS+STE+V+ + E TEVES++ Sbjct: 447 EDDGSDSQDSSRSKEDSNSTESVSSSEEEAQTKNTEVESRK 487
>SL9A1_CRIGR (P48761) Sodium/hydrogen exchanger 1 (Na(+)/H(+) exchanger 1)| (NHE-1) (Solute carrier family 9 member 1) Length = 822 Score = 31.2 bits (69), Expect = 2.5 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 88 VGQEVTVKVLNVARGQVTLTMKGGEDDEDELSSLNTNLKQGWSRGTNAF 234 V +E+ KVL V R LT ++DEDE + K+ S GT+ F Sbjct: 737 VNEELKAKVLGVNRDPTRLTRGEEDEDEDEDGVIMMRRKEPSSPGTDVF 785
>PNP_HAEIN (P44584) Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)| (Polynucleotide phosphorylase) (PNPase) Length = 709 Score = 30.0 bits (66), Expect = 5.6 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = +1 Query: 82 LEVGQEVTVKVLNVAR-GQVTLTMK 153 L+VGQEV VKV+ + R G++ LTMK Sbjct: 665 LQVGQEVNVKVVEIDRQGRIRLTMK 689
>YABR_BACSU (P37560) Hypothetical protein yabR| Length = 128 Score = 29.6 bits (65), Expect = 7.3 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +1 Query: 4 LPDGEEGFLPREEEAAALFTLIGHSALEVGQEVTVKVLNVAR-GQVTLTMKGGEDDEDEL 180 LP G G L E A + + L+VG +V VKV+NV + G++ L++K +D Sbjct: 25 LPGGSTG-LVHISEVADNYVKDINDHLKVGDQVEVKVINVEKDGKIGLSIKKAKDRPQAR 83 Query: 181 SSLNTNLKQGWSRGTNAF 234 + K+ + + N F Sbjct: 84 PRNDFRPKESFEQKMNKF 101
>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein| Length = 312 Score = 29.6 bits (65), Expect = 7.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 27 PPKGRGSSGTVYPYRAFRAGSWSRGNGE 110 PP+G+G + TV+P A G W+ G GE Sbjct: 157 PPQGQGQA-TVFPGLATAGGDWTEGAGE 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,718,353 Number of Sequences: 219361 Number of extensions: 1101652 Number of successful extensions: 3273 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3272 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)