Clone Name | bah62k12 |
---|---|
Clone Library Name | barley_pub |
>BTNL3_HUMAN (Q6UXE8) Butyrophilin-like protein 3 precursor (Butyrophilin-like| receptor) Length = 466 Score = 31.6 bits (70), Expect = 2.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 86 SLDPEALHPELLLRPLSAKSLPPHRRAPRDASPSDERY 199 +LDPE HP+L + L + HR+AP++ S++R+ Sbjct: 291 TLDPETAHPKLCVSDLKTVT---HRKAPQEVPHSEKRF 325
>BTNL8_HUMAN (Q6UX41) Butyrophilin-like protein 8 precursor| Length = 500 Score = 31.6 bits (70), Expect = 2.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 86 SLDPEALHPELLLRPLSAKSLPPHRRAPRDASPSDERY 199 +LDPE HP+L + L + HR+AP++ S++R+ Sbjct: 291 TLDPETAHPKLCVSDLKTVT---HRKAPQEVPHSEKRF 325
>HPLN4_HUMAN (Q86UW8) Hyaluronan and proteoglycan link protein 4 precursor| (Brain link protein 2) Length = 402 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 187 RGRCISGRSSVRWQTLGTQRPEEKL-GVECFRVEGSPNQASGDW 59 R RC R VR +LG +L GV C+R G+P+ A G W Sbjct: 336 RARCGGRRPGVR--SLGFPDATRRLFGVYCYRAPGAPDPAPGGW 377
>HPLN4_MOUSE (Q80WM4) Hyaluronan and proteoglycan link protein 4 precursor| (Brain link protein 2) (Link protein 4) Length = 400 Score = 30.8 bits (68), Expect = 3.6 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = -2 Query: 187 RGRCISGRSSVRWQTLGTQRPEEKL-GVECFRVEGSPNQASGDWLAAVAA----EAPKRN 23 R RC R VR +LG +L GV C+R G+P+ A G W A R+ Sbjct: 334 RTRCGGPRPGVR--SLGFPDASRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGSRD 391 Query: 22 PSGW 11 P+ W Sbjct: 392 PAAW 395
>Y183_TREPA (O83213) Hypothetical protein TP0183 precursor| Length = 281 Score = 30.4 bits (67), Expect = 4.8 Identities = 26/71 (36%), Positives = 32/71 (45%), Gaps = 6/71 (8%) Frame = -1 Query: 278 AAKCSKRVRKLVESVVKLSSPAA------DACRSARQREMHLGALVGAVADSWHSTAGGE 117 AA+ R LV V S P + R R E + +L A+A SWHST GE Sbjct: 118 AARILLDSRHLVRDVFDRSVPLTGNQTETSSMRHTRAGEESVSSL-DALAGSWHSTEEGE 176 Query: 116 ARGGVLQGRGI 84 V +GRGI Sbjct: 177 RIVIVSEGRGI 187
>Y184_MYCGE (Q49400) Hypothetical adenine-specific methylase MG184 (EC| 2.1.1.72) (M.MgeORF184P) Length = 317 Score = 29.6 bits (65), Expect = 8.1 Identities = 16/59 (27%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -2 Query: 184 GRCISGRSSVRWQT-LGTQRPEEKLGVECFRVEGSPNQASGDWLAAVAAEAPKRNPSGW 11 G+C + + W T LG L CF N DW A+ K P W Sbjct: 192 GKCFQKIAGISWFTNLGKPHYNPFLNTNCFYKNNEKNYPKFDWYDAIYVNKIKNIPMDW 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,308,032 Number of Sequences: 219361 Number of extensions: 1768469 Number of successful extensions: 5419 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5399 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)