ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baalp18 |
|---|---|
| Clone Library Name | barley_pub |
>SPD1_ARATH (Q9ZUB3) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 334 Score = 39.7 bits (91), Expect(2) = 7e-05 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +PMWPGEAHSLKVEK+L+ Sbjct: 52 SPMWPGEAHSLKVEKVLF 69 Score = 24.3 bits (51), Expect(2) = 7e-05 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 38 QXSEAKCHATVVSGWFT 88 Q E C +TV+ GWF+ Sbjct: 33 QKKEPACFSTVIPGWFS 49
>SPD2_ARATH (O48661) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 340 Score = 41.6 bits (96), Expect = 6e-04 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 10/48 (20%) Frame = +3 Query: 78 GGSQETRSRSGKPSKAQYFNN----------PMWPGEAHSLKVEKILY 191 GG+ ET + G+ + ++ PMWPGEAHSLKVEKIL+ Sbjct: 26 GGAMETENGGGEIKEPSCMSSIIPGWFSEISPMWPGEAHSLKVEKILF 73
>SPD1_PEA (Q9ZTR1) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 334 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +PMWPGEAHSLKVEKIL+ Sbjct: 51 SPMWPGEAHSLKVEKILF 68
>SPDE_COFAR (O82147) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 316 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +PMWPGEAHSLKVEKIL+ Sbjct: 32 SPMWPGEAHSLKVEKILF 49
>SPD1_ORYSA (Q9SMB1) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 323 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +PMWPGEAHSLKVEK+L+ Sbjct: 39 SPMWPGEAHSLKVEKVLF 56
>SPD2_PEA (Q9ZTR0) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 342 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +PMWPGEAHSLK+EKIL+ Sbjct: 59 SPMWPGEAHSLKIEKILF 76
>SPD1_HYONI (O48658) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 315 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 32 SPLWPGEAHSLKVEKILF 49
>SPD2_DATST (Q96557) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 317 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 34 SPLWPGEAHSLKVEKILF 51
>SPDE_NICSY (O48660) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (Aminopropyltransferase) Length = 314 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 30 SPLWPGEAHSLKVEKILF 47
>SPD2_HYONI (O48659) Spermidine synthase 2 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 2) (SPDSY 2) Length = 308 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 24 SPLWPGEAHSLKVEKILF 41
>SPD1_DATST (Q96556) Spermidine synthase 1 (EC 2.5.1.16) (Putrescine| aminopropyltransferase 1) (SPDSY 1) Length = 308 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 24 SPLWPGEAHSLKVEKILF 41
>SPDE_LYCES (Q9ZS45) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 342 Score = 38.9 bits (89), Expect = 0.004 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 +P+WPGEAHSLKVEKIL+ Sbjct: 59 SPLWPGEAHSLKVEKILF 76
>SPEE_YEAST (Q12074) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 293 Score = 30.4 bits (67), Expect(2) = 0.20 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = +3 Query: 135 NNPMWPGEAHSLKVEKILY 191 ++ MWPG+A +LKVEK+L+ Sbjct: 19 SDTMWPGQAMTLKVEKVLH 37 Score = 21.6 bits (44), Expect(2) = 0.20 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 Query: 59 HATVVSGWFTGNPLALW 109 H T+V GWF +W Sbjct: 7 HPTIVDGWFREISDTMW 23
>PMT3_TOBAC (Q9SEH5) Putrescine N-methyltransferase 3 (EC 2.1.1.53) (PMT 3)| Length = 381 Score = 32.7 bits (73), Expect = 0.27 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +3 Query: 99 SRSGKPSKAQYFNNPMWPGEAHSLKVEKILY 191 S S KP F+ +WPGEA SLKVEK+L+ Sbjct: 87 SNSIKPGWFSEFS-ALWPGEAFSLKVEKLLF 116
>PMT1_TOBAC (Q42963) Putrescine N-methyltransferase 1 (EC 2.1.1.53) (PMT 1)| (A411) Length = 375 Score = 32.3 bits (72), Expect = 0.35 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 36 GXNLRPSATLLWCPGGSQETRSRSGKPSKAQYFNNPMWPGEAHSLKVEKILY 191 G + + + T+ G S S KP F+ +WPGEA SLKVEK+L+ Sbjct: 60 GTSEQQNGTISHDNGNELLGSSDSIKPGWFSEFS-ALWPGEAFSLKVEKLLF 110
>SPEE_SCHPO (Q09741) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 298 Score = 32.0 bits (71), Expect = 0.46 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +3 Query: 138 NPMWPGEAHSLKVEKILY 191 N MWPG+A +LKV+K+LY Sbjct: 20 NNMWPGQAMTLKVKKVLY 37
>PMT4_TOBAC (Q9SEH4) Putrescine N-methyltransferase 4 (EC 2.1.1.53) (PMT 4)| Length = 419 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 144 MWPGEAHSLKVEKILY 191 +WPGEA SLKVEK+L+ Sbjct: 139 LWPGEAFSLKVEKLLF 154
>PMT2_TOBAC (Q9SEH7) Putrescine N-methyltransferase 2 (EC 2.1.1.53) (PMT 2)| Length = 353 Score = 31.6 bits (70), Expect = 0.60 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 144 MWPGEAHSLKVEKILY 191 +WPGEA SLKVEK+L+ Sbjct: 73 LWPGEAFSLKVEKLLF 88
>SPEE_NEUCR (Q9Y8H7) Spermidine synthase (EC 2.5.1.16) (Putrescine| aminopropyltransferase) (SPDSY) Length = 291 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 Query: 144 MWPGEAHSLKVEKILY 191 MWPG+A +LKVEK+L+ Sbjct: 20 MWPGQAMTLKVEKVLH 35
>SWD1_YEAST (P39706) COMPASS component SWD1 (Complex proteins associated with| SET1 protein SWD1) (Set1C component SWD1) Length = 426 Score = 29.3 bits (64), Expect = 3.0 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 12/60 (20%) Frame = +3 Query: 6 PCCVKGASCCGXNLRPSATLLWCPGG------SQE------TRSRSGKPSKAQYFNNPMW 149 P CV G + G ++RP ++ W P G S++ S+ KP K F++P+W Sbjct: 60 PICVPG-NMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLKEIRFDSPIW 118
>VID21_GIBZE (Q4IB96) Chromatin modification-related protein VID21| Length = 1629 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 112 LPERERVSCEPPGHHSSV 59 +P R +SC+PP HHS V Sbjct: 10 IPSRSALSCKPPKHHSIV 27
>MCSP_HUMAN (P49901) Sperm mitochondrial-associated cysteine-rich protein| Length = 116 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 3 PPCCVKGASCCGXNLRPSATLL 68 PPCC++ A CCG +P + L Sbjct: 63 PPCCIQ-ARCCGLETKPEVSPL 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,442,914 Number of Sequences: 219361 Number of extensions: 470225 Number of successful extensions: 1429 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
