Clone Name | baalo18 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | POL_MMTVB (P03365) Pol polyprotein [Contains: Reverse transcript... | 32 | 1.6 | 2 | POL_MMTVC (P11283) Pol polyprotein [Contains: Reverse transcript... | 32 | 1.6 |
---|
>POL_MMTVB (P03365) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 899 Score = 32.0 bits (71), Expect = 1.6 Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -2 Query: 230 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW*KSSNGLRPSFLNK*NSGVQTALKXL 54 N WPL + + L+ L VT L LG LE SN PW P F+ K SG L+ L Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW------NTPVFVIKKKSGKWRLLQDL 81 Query: 53 GNXLETHH 30 T H Sbjct: 82 RAVNATMH 89
>POL_MMTVC (P11283) Pol polyprotein [Contains: Reverse transcriptase (EC| 2.7.7.49); Endonuclease] (Fragment) Length = 114 Score = 32.0 bits (71), Expect = 1.6 Identities = 26/68 (38%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -2 Query: 230 NSWPLSAQSIARLKSLPVTGTLLLG-LESSNCPW*KSSNGLRPSFLNK*NSGVQTALKXL 54 N WPL + + L+ L VT L LG LE SN PW P F+ K SG L+ L Sbjct: 29 NQWPLKQEKLQALQQL-VTEQLQLGHLEESNSPW------NTPVFVIKKKSGKWRLLQDL 81 Query: 53 GNXLETHH 30 T H Sbjct: 82 RAVNATMH 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,993,221 Number of Sequences: 219361 Number of extensions: 1675578 Number of successful extensions: 4211 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4211 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)