Clone Name | baalm18 |
---|---|
Clone Library Name | barley_pub |
>SYFB_BUCAP (P59057) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 798 Score = 29.6 bits (65), Expect = 3.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 380 CGESVXTINSKRDRYQSLACSNSQK 454 CG + IN+K+ + SL+CSN K Sbjct: 384 CGGKIGPINTKKSNFNSLSCSNKIK 408
>EME1_SCHPO (Q9C103) Crossover junction endonuclease eme1 (EC 3.1.22.-)| (Essential meiotic endonuclease 1) Length = 738 Score = 29.6 bits (65), Expect = 3.8 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = -1 Query: 258 DTPPRSTKCTAATR-FPLILVDDEEDTSPPSELSVLLGVEKNLPDSVLVYL 109 DTP RST+C + + F LV ED P ++ + +K++ D++L+ L Sbjct: 47 DTPQRSTQCDSLLKSFSTPLVSGSEDVLPSPRDALNITNKKSVTDNLLLSL 97
>Y4DW_RHISN (P55422) Hypothetical 22.9 kDa protein y4dW| Length = 204 Score = 29.3 bits (64), Expect = 5.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 151 RRRKEPSRQRPGVPQERWPSAGSLCAAMRALLP 53 ++RK R RP +P+E+WP+ +A A +P Sbjct: 154 QKRKRGYRPRPSLPKEKWPAEAEHESATSAPVP 186
>YD73_SCHPO (Q10328) Putative homeobox protein C32A11.03c in chromosome I| Length = 942 Score = 28.9 bits (63), Expect = 6.6 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -1 Query: 249 PRSTKCT-AATRFPLILVDDEEDTSPPSELSVLLGVEKNLPD-SVLVYLRNDGHLPALCA 76 P+S K A + +L + +DT+PP + +G E N+P+ SV ++ +N L + Sbjct: 166 PKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKSKLIS 225 Query: 75 RR 70 RR Sbjct: 226 RR 227
>CTTB2_CALJA (Q2QLF8) Cortactin-binding protein 2 (CortBP2)| Length = 1662 Score = 28.9 bits (63), Expect = 6.6 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%) Frame = +3 Query: 183 CPLHR------RRGLEGSAWPPCISSNAAACPVPK--SALWRSMWTRTRQLAGRF 323 CPL R R +G ++P I S+ +C K S WR + T R+ +GRF Sbjct: 1414 CPLPRAELEQHRADFKGGSFPLSIVSSYNSCSKKKGESGAWRKVNTSPRRKSGRF 1468 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,135,553 Number of Sequences: 219361 Number of extensions: 1073643 Number of successful extensions: 3700 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3696 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)