Clone Name | baall03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PEX3_PICAN (Q01497) Peroxisomal biogenesis factor 3 (Peroxin-3) ... | 30 | 5.7 | 2 | PRMA_PROMA (Q7VAM5) Ribosomal protein L11 methyltransferase (EC ... | 30 | 7.4 |
---|
>PEX3_PICAN (Q01497) Peroxisomal biogenesis factor 3 (Peroxin-3) (Peroxisomal| membrane protein PER9) Length = 457 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 174 EKAKGKHSGLNLYSKQ---WGQMEKSSKSEMLWLLYMPCMATYFLHMEVGVVS 323 EK H+G+ + W ++ S + L LLY + FLH+++ ++S Sbjct: 129 EKENPMHTGVQQTKSKTQLWNELRNQSITRFLTLLYCESLLIVFLHLQLNILS 181
>PRMA_PROMA (Q7VAM5) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 304 Score = 29.6 bits (65), Expect = 7.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 386 ELSPYFLTSYHLYINICISLVVVANLSEV 472 EL+PYF H Y +C+S ++VA + ++ Sbjct: 246 ELAPYFFKLTHSYSRLCLSGLLVAQVEDI 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,311,569 Number of Sequences: 219361 Number of extensions: 1902508 Number of successful extensions: 4312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4311 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)