Clone Name | baall02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y873_METJA (Q58283) Hypothetical ABC transporter ATP-binding pro... | 32 | 1.2 | 2 | CIDEC_HUMAN (Q96AQ7) Cell death activator CIDE-3 (Cell death-ind... | 32 | 2.1 | 3 | Y525_METKA (P50100) Hypothetical protein MK0525 (OrfX) | 30 | 6.0 | 4 | ROCA_BACC1 (P62028) 1-pyrroline-5-carboxylate dehydrogenase (EC ... | 26 | 7.7 |
---|
>Y873_METJA (Q58283) Hypothetical ABC transporter ATP-binding protein MJ0873| Length = 290 Score = 32.3 bits (72), Expect = 1.2 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +1 Query: 424 PYV-LFIQKTLRRRPFLIKSLENVMRKFLQSLEFFE--ENERQKLAIFTALAFSQKLSGL 594 PY LF + T R + +I+S V ++L FFE + ERQK+ I ALA K+ L Sbjct: 102 PYTDLFGRLTERDKKIIIESARAVNAEYLLEKNFFEMSDGERQKIMIARALAQEPKVLIL 161 Query: 595 PPETVF 612 T F Sbjct: 162 DEPTSF 167
>CIDEC_HUMAN (Q96AQ7) Cell death activator CIDE-3 (Cell death-inducing DFFA-like| effector protein C) (Fat-specific protein FSP27 homolog) Length = 238 Score = 31.6 bits (70), Expect = 2.1 Identities = 19/50 (38%), Positives = 27/50 (54%) Frame = +1 Query: 241 LELVAKSIESSDLNFSRYGDTFFEVVFIGVRTQPGTIKPEEEGERHPYSL 390 LE ++E+ + + GDT F V+ G + QP P E+G RHP SL Sbjct: 85 LEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQP----PSEQGTRHPLSL 130
>Y525_METKA (P50100) Hypothetical protein MK0525 (OrfX)| Length = 196 Score = 30.0 bits (66), Expect = 6.0 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 7/81 (8%) Frame = +1 Query: 310 EVVFIGVRTQPG-TIKPEEEGERHPYSLIDCSAQREAI------LPYVLFIQKTLRRRPF 468 EV+ + +QP T++ + E ++D +R I L ++ +Q L+ P+ Sbjct: 69 EVIARDIMSQPVITVEEDMEVNEAVKLMVDKGIRRLPIVDDNGKLIGIVTMQDILQVEPY 128 Query: 469 LIKSLENVMRKFLQSLEFFEE 531 L+ ++E M+KF + LE EE Sbjct: 129 LVATIEEEMKKFQEELEELEE 149
>ROCA_BACC1 (P62028) 1-pyrroline-5-carboxylate dehydrogenase (EC 1.5.1.12) (P5C| dehydrogenase) Length = 515 Score = 26.2 bits (56), Expect(2) = 7.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 217 IYLDNAGDLELVAKSIESSDLNFS 288 I +D DLEL AKSI +S FS Sbjct: 293 IVVDKEADLELAAKSIVASAFGFS 316 Score = 21.9 bits (45), Expect(2) = 7.7 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 6 FXHSSHYRLGGRTTDPPTRATISFTSPLLAXIVVYELEGEAHP 134 F S +G D P ISFT I +YE + +P Sbjct: 233 FVPGSGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNP 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,332,148 Number of Sequences: 219361 Number of extensions: 1524452 Number of successful extensions: 3833 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3833 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)