Clone Name | baali23 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YKZ7_YEAST (P36113) RING finger protein YKR017C | 31 | 0.99 | 2 | RGF3_SCHPO (Q9Y7U5) Rho1 guanine nucleotide exchange factor 3 | 28 | 4.9 |
---|
>YKZ7_YEAST (P36113) RING finger protein YKR017C| Length = 551 Score = 30.8 bits (68), Expect = 0.99 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 108 CK*ETGWGVSSPLEEKRDPVVGWLLNNTNMCPRCLFQLKK 227 CK T W + K ++ W+L++T CP+C ++K Sbjct: 314 CKITTAWVKKA---RKESEILNWVLSHTKECPKCSVNIEK 350
>RGF3_SCHPO (Q9Y7U5) Rho1 guanine nucleotide exchange factor 3| Length = 1275 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 155 FLLQRRRNAPSRFSFT*SDPDVSINGRNQAS 63 FL +R N+P RFS++ SIN R AS Sbjct: 59 FLSKRSNNSPHRFSYSPPQHPASINSRRVAS 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,066,962 Number of Sequences: 219361 Number of extensions: 765283 Number of successful extensions: 2142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2142 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)