>Y417_CHLTR (O84422) Probable metal transport system membrane protein CT_417|
          Length = 293

 Score = 29.3 bits (64), Expect = 8.8
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 7/71 (9%)
 Frame = +1

Query: 271 EMLMVVNIDLQGSSFRALSFRKSLKGMKHQSLFRQGLL-------KSLVLMASITAIIQL 429
           ++ +V  + +  + F AL F +    + H S+    LL        ++VLM  +  I+ L
Sbjct: 150 DLFIVATVSICHTRFLALCFDEKYMALNHYSIKTWYLLLLILTAITTVVLMYVMGVILML 209

Query: 430 TQAMLPLSLDC 462
           +  +LP+S+ C
Sbjct: 210 SMLVLPVSIAC 220


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 71,372,042
Number of Sequences: 219361
Number of extensions: 1224127
Number of successful extensions: 2723
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2676
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2723
length of database: 80,573,946
effective HSP length: 106
effective length of database: 57,321,680
effective search space used: 5101629520
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)