Clone Name | baalh18 |
---|---|
Clone Library Name | barley_pub |
>HIF1A_ONCMY (Q98SW2) Hypoxia-inducible factor 1 alpha (HIF-1 alpha) (HIF1| alpha) Length = 766 Score = 32.0 bits (71), Expect = 0.36 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -1 Query: 225 TERS*YAVQ*DRYNHTCRTKNVRSINWRMRRCSSHLNXGEDDCECLP 85 TERS + + RT NV+S W++ CS H+ E E +P Sbjct: 165 TERSFFLRMKCTLTNRGRTVNVKSATWKVLHCSDHVRVHESPAEQIP 211
>AT2C2_HUMAN (O75185) Probable calcium-transporting ATPase KIAA0703 (EC 3.6.3.8)| Length = 963 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +2 Query: 11 VSXPXVHGI--QXSAPSWRSTCPW 76 +S P +HG+ Q AP W S CPW Sbjct: 30 LSLPHLHGVFEQVPAPWWTSLCPW 53
>WDR6_HUMAN (Q9NNW5) WD-repeat protein 6| Length = 1121 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 147 WRMRRCSSHLNXGEDDCECLPWFXQGHVLR 58 W+++ ++L +DC CL W +G +L+ Sbjct: 262 WQVKLLENYLISAGEDCVCLVWSHEGEILQ 291
>KCNH2_CHICK (Q9PT84) Potassium voltage-gated channel subfamily H member 2| (Voltage-gated potassium channel subunit Kv11.1) (Ether-a-go-go-related gene potassium channel 1) (ERG1) (Ether-a-go-go-related protein 1) (Eag-related protein 1) (Fragment) Length = 526 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -2 Query: 143 ECGVALHISXLVRMTVNVXPGSXRGMYCAMMARXXEXHVPPXPILVH 3 + + LH++ + G+ +G A+ + H PP LVH Sbjct: 429 QADICLHLNRTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVH 475
>KCNH7_RAT (O54852) Potassium voltage-gated channel subfamily H member 7| (Voltage-gated potassium channel subunit Kv11.3) (Ether-a-go-go-related gene potassium channel 3) (Ether-a-go-go-related protein 3) (Eag-related protein 3) Length = 1195 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -2 Query: 143 ECGVALHISXLVRMTVNVXPGSXRGMYCAMMARXXEXHVPPXPILVH 3 + + LH++ + G+ +G A+ + H PP LVH Sbjct: 728 QADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVH 774
>KCNH7_MOUSE (Q9ER47) Potassium voltage-gated channel subfamily H member 7| (Voltage-gated potassium channel subunit Kv11.3) (Ether-a-go-go-related gene potassium channel 3) (Ether-a-go-go-related protein 3) (Eag-related protein 3) Length = 1195 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = -2 Query: 143 ECGVALHISXLVRMTVNVXPGSXRGMYCAMMARXXEXHVPPXPILVH 3 + + LH++ + G+ +G A+ + H PP LVH Sbjct: 728 QADICLHLNQTLLQNCKAFRGANKGCLRALAMKFKTTHAPPGDTLVH 774 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,469,931 Number of Sequences: 219361 Number of extensions: 995605 Number of successful extensions: 2219 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2219 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)