| Clone Name | baalg05 |
|---|---|
| Clone Library Name | barley_pub |
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.4 bits (67), Expect = 1.0 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPILRRW 378 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 224 RTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 108 RTAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 378 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>YLU3_CAEEL (P34397) Hypothetical protein F10E9.3| Length = 362 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 79 VGLQRGNA**ARVISSR*LRPCPLYTPPVAPT 174 +GL RG A ++ ++ LRP P TPP+A T Sbjct: 113 LGLNRGGAIPKALLLNKNLRPVPSKTPPIATT 144
>TRMB_STAS1 (Q49YH9) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 211 Score = 28.9 bits (63), Expect = 3.0 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 38 LGKFHRDGDRSLQLLVFNEGMPSKRESSARVDYVPALCTHRPSLLPIEWSGEV-FGSRRR 214 L + +DG+ S L F++ P KR + R+ Y L ++ L + GE+ F + R Sbjct: 99 LNDYFKDGEVSRLYLNFSDPWPKKRHTKRRLTYQTYLALYKQVL---KDDGEIHFKTDNR 155 Query: 215 GRFA 226 G FA Sbjct: 156 GLFA 159
>TRMB_STAHJ (Q4L792) tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33)| (tRNA(m7G46)-methyltransferase) Length = 214 Score = 28.1 bits (61), Expect = 5.2 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +2 Query: 38 LGKFHRDGDRSLQLLVFNEGMPSKRESSARVDYVPALCTHRPSLLPIEWSGEV-FGSRRR 214 L ++ DG+ S L F++ P KR + R+ Y L ++ L + GE+ F + R Sbjct: 99 LNEYFNDGEISRIYLNFSDPWPKKRHAKRRLTYHTFLALYQQIL---KEDGEIHFKTDNR 155 Query: 215 GRFA 226 G FA Sbjct: 156 GLFA 159
>PLMN_MOUSE (P20918) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 378 G + +FP NL+ ++CR+PD + RP C +RW Sbjct: 218 GYIPAKFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRW 254
>PLMN_BOVIN (P06868) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 378 G + ++FP NL+ ++CR+PD + RP C +RW Sbjct: 225 GYIPSKFPNKNLKMNYCRNPDGEPRPWCFTTDPQKRW 261
>LARP4_HUMAN (Q71RC2) La-related protein 4 (La ribonucleoprotein domain family| member 4) Length = 723 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 264 FRGRRSR--NKVSVGEPAEGSLS*P*PKQTVLASSNPP 371 FRGRR R +++S P+ P PK +LAS+ PP Sbjct: 448 FRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPP 485
>PLMN_RAT (Q01177) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 378 G + +FP NL+ ++CR+PD + RP C +RW Sbjct: 218 GYIPAKFPSKNLKMNYCRNPDGEPRPWCFTTDPNKRW 254
>PLMN_ERIEU (Q29485) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 274 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 378 G + ++FP NL+ ++CR+PD + RP C +RW Sbjct: 218 GFIPSKFPSKNLKMNYCRNPDGEPRPWCFTMDRNKRW 254
>DPOL_METTH (O27276) DNA polymerase (EC 2.7.7.7)| Length = 586 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 311 RRFTYGNLVTTSPSSK**GSMDFSRRRGRR 222 + + YG LV PS DFS RRGRR Sbjct: 396 KAYQYGELVPNKPSQS-----DFSSRRGRR 420
>PCGF6_MOUSE (Q99NA9) Polycomb group RING finger protein 6 (RING finger protein| 134) (Mel18 and Bmi1-like RING finger) Length = 353 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 243 LATSGAANRPRRRDPNTSPDHSIGRSDGR 157 L +GAA R R P P+ S+GR GR Sbjct: 52 LGQAGAAGCSRSRPPALEPERSLGRLRGR 80
>RL3_THETN (Q8R7V4) 50S ribosomal protein L3| Length = 210 Score = 27.3 bits (59), Expect = 8.9 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -1 Query: 305 FTYGNLVTTSPSSK**GSMDFSRRRGRRTAPVAAIRTLHRTIQSVGAT---GGVYKGQ 141 F G+ V + SK G +R G R P++ HR + S+GAT G +KG+ Sbjct: 102 FKPGDRVDVTGISKGKGFAGVIKRYGARRGPMSHGSKYHRRVGSMGATTDPGRTFKGK 159
>ODO1_YEAST (P20967) 2-oxoglutarate dehydrogenase E1 component, mitochondrial| precursor (EC 1.2.4.2) (Alpha-ketoglutarate dehydrogenase) Length = 1014 Score = 27.3 bits (59), Expect = 8.9 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +2 Query: 26 GPGNLGKFHRDGDRSLQLLVFNEGMPSKRESSARVDYVPALCTHRPSLLPIEWSGE 193 GPG L +F RDG + L + + SS V Y TH PS +W E Sbjct: 180 GPGILPRFARDGKSKMSLKEIVDHLEKLYCSSYGVQY-----THIPSKQKCDWLRE 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,026,590 Number of Sequences: 219361 Number of extensions: 1149444 Number of successful extensions: 2700 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2700 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)