| Clone Name | baale19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CF010_HUMAN (Q5SRN2) Protein C6orf10 | 33 | 0.36 | 2 | LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper moti... | 29 | 5.1 | 3 | VG15_BPPH8 (P14815) Replication protein 15 | 29 | 6.7 | 4 | DPOL_HPBGS (P03161) P protein (A protein) [Includes: DNA-directe... | 28 | 8.7 | 5 | FADA_PSEPK (Q88L01) 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Fatty... | 28 | 8.7 | 6 | BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein... | 28 | 8.7 |
|---|
>CF010_HUMAN (Q5SRN2) Protein C6orf10| Length = 563 Score = 33.1 bits (74), Expect = 0.36 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 4 RGVATQVGPSIHRRPAGKSCAKDRSGLIIINGAKPRISAPRNGVTQRKRSSVTTS 168 RG +QV S P G+ +SGL+++ G + ++ GV +R+ S V S Sbjct: 332 RGQESQVKKSESGVPKGQEAQVTKSGLVVLKGQEAQVEKSEMGVPRRQESQVKKS 386
>LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper motif-containing| protein) Length = 1051 Score = 29.3 bits (64), Expect = 5.1 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 9/40 (22%) Frame = -3 Query: 306 SLLVKPSSSLNRNT---------WKLQTVLSSVQAAATRH 214 S+L+KPS S+ RN+ WK + S V ++ TRH Sbjct: 879 SILIKPSDSVERNSHAFPAETIRWKSHSTSSEVASSDTRH 918
>VG15_BPPH8 (P14815) Replication protein 15| Length = 302 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 93 QWGEAEDLSTEKWCHTTKTLIGHHLVHD*SANWKN 197 +WG AEDL T KW + LI +W N Sbjct: 192 KWGSAEDLETAKWISSRVKLINPTCKAPDMTSWSN 226
>DPOL_HPBGS (P03161) P protein (A protein) [Includes: DNA-directed DNA| polymerase (EC 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 881 Score = 28.5 bits (62), Expect = 8.7 Identities = 27/93 (29%), Positives = 39/93 (41%), Gaps = 6/93 (6%) Frame = +2 Query: 98 GRSRGSQHREMVSHNENAHRSPPRSRLISKLEESDGQSLCLVAAACTLLST------VCN 259 G+ +HR++ HN H+S RS+ IS C+VA + LL T N Sbjct: 175 GKPYSWEHRQLEQHNGQQHKSNIRSQQIS----------CMVANSGNLLYTHYHRDKSSN 224 Query: 260 FQVFLLSDDDGFTNKEISEFVTGTMEFAICYSY 358 Q LSD+ +KE + CY+Y Sbjct: 225 IQTRNLSDNVFKKSKESTR--------VRCYTY 249
>FADA_PSEPK (Q88L01) 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (Fatty oxidation| complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) Length = 391 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 95 MGRSRGSQHREMVSHNENAHRSPPRSRLISKLEESDGQ 208 MGRS+G HR + + +AH LISKL E +G+ Sbjct: 18 MGRSKGGMHRNTRAEDMSAH-------LISKLLERNGK 48
>BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein homolog| Length = 1849 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -3 Query: 303 LLVKPSSSLNRNTWKLQTVLSSVQAAATRHNDCPSDSSSLLINRERG 163 L + ++ N KLQ ++ ++A RH PS SS+ L RG Sbjct: 1387 LTTQQRDTMQDNLLKLQQEMAELEAVLERHGSQPSHSSASLTADSRG 1433 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,053,361 Number of Sequences: 219361 Number of extensions: 1439049 Number of successful extensions: 3722 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3722 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)