Clone Name | baale02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CF010_HUMAN (Q5SRN2) Protein C6orf10 | 34 | 0.40 | 2 | ACOD_MESAU (Q64420) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl... | 30 | 4.4 | 3 | ABCG3_MOUSE (Q99P81) ATP-binding cassette sub-family G member 3 | 30 | 5.7 | 4 | ACOD1_RAT (P07308) Acyl-CoA desaturase 1 (EC 1.14.19.1) (Stearoy... | 29 | 9.8 | 5 | LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper moti... | 29 | 9.8 |
---|
>CF010_HUMAN (Q5SRN2) Protein C6orf10| Length = 563 Score = 33.9 bits (76), Expect = 0.40 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 68 IDRGVATQVGPSIHRRPAGKSCAKDRSGLIIINGAKPRISAPRNGVTQRKRSSVTTS 238 + RG +QV S P G+ +SGL+++ G + ++ GV +R+ S V S Sbjct: 330 VPRGQESQVKKSESGVPKGQEAQVTKSGLVVLKGQEAQVEKSEMGVPRRQESQVKKS 386
>ACOD_MESAU (Q64420) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-CoA| desaturase) (Fatty acid desaturase) (Delta(9)-desaturase) Length = 354 Score = 30.4 bits (67), Expect = 4.4 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 453 ILPNFAPLKSWIKWGRNFRIFRDTGVFVTISYLLLLDISWRIRLACHL 596 ILP F P W WG F V + Y L+L+ +W + A HL Sbjct: 223 ILPTFVP---WYFWGEAF--VNSLCVSTFLRYTLVLNATWLVNSAAHL 265
>ABCG3_MOUSE (Q99P81) ATP-binding cassette sub-family G member 3| Length = 650 Score = 30.0 bits (66), Expect = 5.7 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +3 Query: 399 TMEFAICYSYIFLKLHELILPNFAPLKSWIKWGRNFRIFRDTGVFVTISYLLLLDI 566 T E + C++Y+ E ++ L SW W + + + +TI+Y+ LL + Sbjct: 589 TEEVSRCHNYVICTGEEFLMIQGIDLSSWGFWENHLALVCTMIILLTITYVQLLQV 644
>ACOD1_RAT (P07308) Acyl-CoA desaturase 1 (EC 1.14.19.1) (Stearoyl-CoA| desaturase 1) (Fatty acid desaturase 1) (Delta(9)-desaturase 1) Length = 358 Score = 29.3 bits (64), Expect = 9.8 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +3 Query: 453 ILPNFAPLKSWIKWGRNFRIFRDTGVFVTISYLLLLDISWRIRLACHL 596 ILP P W WG F V + Y L+L+ +W + A HL Sbjct: 227 ILPTLVP---WYCWGETF--LHSLFVSTFLRYTLVLNATWLVNSAAHL 269
>LUZP1_RAT (Q9ESV1) Leucine zipper protein 1 (Leucine zipper motif-containing| protein) Length = 1051 Score = 29.3 bits (64), Expect = 9.8 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 9/40 (22%) Frame = -1 Query: 376 SLLVKPSSSLNRNT---------WKLQTVLSSVQAAATRH 284 S+L+KPS S+ RN+ WK + S V ++ TRH Sbjct: 879 SILIKPSDSVERNSHAFPAETIRWKSHSTSSEVASSDTRH 918 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,958,608 Number of Sequences: 219361 Number of extensions: 1998651 Number of successful extensions: 4941 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4941 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)