Clone Name | baalc15 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to riboso... | 43 | 5e-04 | 2 | TAR1_KLULA (Q6CQE5) Protein TAR1 | 41 | 0.002 | 3 | DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED ... | 30 | 3.5 |
---|
>TAR1_YEAST (Q8TGM6) Protein TAR1 (Transcript antisense to ribosomal RNA| protein 1) Length = 124 Score = 43.1 bits (100), Expect = 5e-04 Identities = 24/59 (40%), Positives = 33/59 (55%) Frame = -1 Query: 554 ESPAHSSTGTRSEITFPSHCLGAQHGFTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 378 +SP H R++ T + FT++FT FFS F H T SLSV+++YLAL G Sbjct: 3 DSPTHKEQ--RAQNTMSDQMPFPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 59
>TAR1_KLULA (Q6CQE5) Protein TAR1| Length = 109 Score = 41.2 bits (95), Expect = 0.002 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -1 Query: 482 HGFTFYFTTHWGFFSPFPHGTTSLSVTQEYLALQG 378 + FT++FT FFS F H T SLSV+++YLAL G Sbjct: 10 NNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDG 44
>DNJ15_ARATH (Q9ZSY2) Chaperone protein dnaJ 15 (Protein ALTERED RESPONSE TO| GRAVITY) (AtARG1) (AtJ15) (AtDjB15) Length = 410 Score = 30.4 bits (67), Expect = 3.5 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 111 GDNLAN*NILVARGKESKSDSRSSGERNGSSLNRE 215 G+NL+N + A+G ESK D S+GE G+ NR+ Sbjct: 358 GNNLSNGSSSKAQGDESKGDGDSAGEEGGTE-NRD 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,613,152 Number of Sequences: 219361 Number of extensions: 1563228 Number of successful extensions: 3173 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3172 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)