Clone Name | baalb20 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DOC10_HUMAN (Q96BY6) Dedicator of cytokinesis protein 10 (Protei... | 32 | 1.4 | 2 | MTCD_TETTH (Q8WSW3) Cadmium metallothionein precursor (MT-Cd) (C... | 32 | 1.4 |
---|
>DOC10_HUMAN (Q96BY6) Dedicator of cytokinesis protein 10 (Protein zizimin 3)| Length = 2183 Score = 32.0 bits (71), Expect = 1.4 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = -3 Query: 380 VNSLSVLISHSSTGMQTLPQIKGTNRLSMP*RSGISDKTLTPTRTKVLLGHH 225 ++S S H QTLP I+G N LS P + D T+T ++ + HH Sbjct: 1421 MHSTSSHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMTSNSNEIDIVHH 1472
>MTCD_TETTH (Q8WSW3) Cadmium metallothionein precursor (MT-Cd) (Cd-MT)| Length = 162 Score = 32.0 bits (71), Expect = 1.4 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 167 ETGCRLG-ACMQCRNETNASCFVFGKNRACMHARARQPCYTCMC 39 + GC G C + N+ C K C A ++Q C TC C Sbjct: 117 QQGCCCGDKAKACCTDPNSGCCCSNKANKCCDATSKQECQTCQC 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,213,817 Number of Sequences: 219361 Number of extensions: 2118014 Number of successful extensions: 4783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4782 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)